SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007961459.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007961459.1.81039
Domain Number 1 Region: 9-139
Classification Level Classification E-value
Superfamily RUN domain-like 2.62e-30
Family RUN domain 0.00000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007961459.1.81039
Sequence length 403
Comment PREDICTED: RUN and FYVE domain-containing protein 2 isoform X9 [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MATKDPTAVERANLLNMAKLSIKGLIESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKV
RKSFLSYNKTIWGPLELVEKLYPEAEEIGASVRDLPGLNEFYEYHALMMEEEGAVIVGLL
VGLNVIDANLCVKGEDLDSQVGVIDFSMYLKNEEDIGNKERNVQIAAILDQKNYVEELNR
QLNSTVSSLHSRVDSLEKSNTKLIEELAIAKNNIIKLQEENHQLRSENKLILMKTQQHLE
VTKVDVETELQTYKHSRQGLDEMYNEARRQLRDESQLRQDVENELAVQVSMKHEIELAMK
LLEKDIHEKQDTLIGLRQQLEEVKAINIEMYQKLQGSEDGLKEKNEIIARLEEKTNKITA
AMRQLEQSDNDLLTQTRTIAMSLVKCASSDTQDQYKLVKDISF
Download sequence
Identical sequences A0A2I3TWQ7 A0A2K6R9Q5 F7CAF8 F7I3Y7
NP_001035882.1.87134 NP_001035882.1.92137 XP_007961459.1.81039 XP_008954027.1.60992 XP_010373571.1.97406 XP_016773910.1.37143 gi|109240552|ref|NP_001035882.1| ENSP00000382151 ENSP00000382151 ENSCJAP00000035537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]