SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007965965.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007965965.1.81039
Domain Number 1 Region: 42-300
Classification Level Classification E-value
Superfamily Aldolase 1.88e-77
Family Class I aldolase 0.00000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007965965.1.81039
Sequence length 318
Comment PREDICTED: putative deoxyribose-phosphate aldolase [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MSAHNRGTELDLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLS
GDDTSSNIQRLCYKAKYPIREDLLKALNMYDKGITTAAVCVYPARVCDAVKALKAAGCNI
PVASVATGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQFRK
ACGEAHLKTILATGELGSLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAI
RDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQ
IYHHVTGRYAAYHDLPMS
Download sequence
Identical sequences A0A0D9R7I1 A0A2I3N060 A0A2K5J1C3 A0A2K5MA98 A0A2K5U9U9 A0A2K5XZ81 A0A2K6ED78 F6XLA4
ENSMMUP00000017503 9544.ENSMMUP00000017503 ENSMMUP00000017503 XP_005570308.1.63531 XP_007965965.1.81039 XP_011739526.1.29376 XP_011739532.1.29376 XP_011809877.1.43180 XP_011846218.1.47321 XP_011913835.1.92194 XP_015006693.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]