SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007965972.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007965972.1.81039
Domain Number 1 Region: 116-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000437
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 80-112
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000108
Family LIM domain 0.0034
Further Details:      
 
Domain Number 3 Region: 50-80
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000476
Family LIM domain 0.0091
Further Details:      
 
Weak hits

Sequence:  XP_007965972.1.81039
Domain Number - Region: 146-176
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00784
Family LIM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007965972.1.81039
Sequence length 187
Comment PREDICTED: LIM domain only protein 3 isoform X1 [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MYACLDGPEKPNLRNLPMYRTSQLRGSHYSTVSEYRYFSGIQMLSVQPDTKPKGCAGCNR
KIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCA
ACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKE
GYAPQVR
Download sequence
Identical sequences XP_005570312.1.63531 XP_007965972.1.81039 XP_011739443.1.29376 XP_011830826.1.47321 XP_015006589.1.72884 ENSPANP00000007505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]