SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007967615.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007967615.1.81039
Domain Number 1 Region: 22-395
Classification Level Classification E-value
Superfamily SAICAR synthase-like 8.17e-123
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007967615.1.81039
Sequence length 540
Comment PREDICTED: phosphatidylinositol 4-phosphate 5-kinase type-1 beta isoform X1 [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MSSAAENGEAAPGKQNEEKTYKKTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVV
ESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNP
GASGSLFFVTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGG
INIRIVVMNNVLPRSMRMHFTYDLKGSTYKRRASRKEREKSNPTFKDLDFLQDMHEGLYF
DTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHFLDHSLKEKEEETSQNVPDAKRPGMQ
KVLYSTAMESIQGPGKSGDGIITENPDTMGGIPAKSHRGEKLLLFMGIIDILQSYRLMKK
LEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQALKASPSKKRCNSIAALKAT
SQEIVSSISQEWKDEKRDLLTEGQSFSSLDEEALGSRHRPDLVPSTPSLFEAASLATTIS
SSSLYVNEHYPHDRPTLYSNSKGLPSSSTFTLEEGTIYLTTEPNTLEVQDDNASVLDVYL
Download sequence
Identical sequences A0A096P1P6 A0A2K5WNX0 F7FF50
ENSPANP00000019271 XP_005581929.1.63531 XP_005581930.1.63531 XP_007967615.1.81039 XP_007967616.1.81039 XP_014973338.1.72884 XP_014973339.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]