SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007968999.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007968999.1.81039
Domain Number 1 Region: 187-223
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000235
Family CCCH zinc finger 0.00017
Further Details:      
 
Domain Number 2 Region: 150-185
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000471
Family CCCH zinc finger 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007968999.1.81039
Sequence length 492
Comment PREDICTED: zinc finger protein 36, C3H1 type-like 2 [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAPGFLRRHSASN
LHALAHPAPSPGSCSPKFPGAANGSSCGSAAAGGPTSYGTLKEPSGGGGTALLNKENKFR
DRSFSENGDRSQHLLHLQQQQKGGGGSQINSTRYKTELCRPFEESGTCKYGEKCQFAHGF
HELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERRPAPSGGASGDLRAFGTRD
ALHLGFPREPRPKLHHSLSFSGFPSGHHQPPGGLESPLLLDSPTSRTPPPPSCSSASSCS
SSASSCSSASAASTPSAPACCASAAAAAAAALLYGSGGAEDLLAPGAPCAACSSASCANN
AFAFGPELSSLITPLAIQTHNFAAVAAAAYYRSQQQQQQGLAPPAQPPAPPSAPLPAGAA
APPSPPFSFQLPRRLSDSPVFDAPPSPPDSLSDRDSYLSGSLSSGSLSGSESPSLDPGRR
LPIFSRLSISDD
Download sequence
Identical sequences A0A096MWJ3 A0A0D9RJV1 I0FUJ6
ENSPANP00000004249 XP_007968999.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]