SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007970442.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007970442.1.81039
Domain Number 1 Region: 81-219
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.38e-35
Family Glutathione S-transferase (GST), C-terminal domain 0.000000249
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.69e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007970442.1.81039
Sequence length 222
Comment PREDICTED: glutathione S-transferase A1 [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEIYLKSAEDLDKLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGIADLGEMILLLPICPPEEKDAK
IALIKEKTKNRYFSAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDAKSLEEARKIFRF
Download sequence
Identical sequences A0A096NJ80 A0A0D9RKW0 A0A2K5M0G7 A0A2K6ADU0 C0SJM2 F7HKV9
ENSMMUP00000027610 ENSMMUP00000027612 ENSPANP00000013029 NP_001182705.1.72884 XP_007970442.1.81039 XP_011836697.1.47321 XP_011836698.1.47321 XP_011925353.1.92194 ENSMMUP00000022540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]