SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007982694.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007982694.1.81039
Domain Number 1 Region: 2206-2299
Classification Level Classification E-value
Superfamily C-type lectin-like 2.25e-33
Family Link domain 0.00012
Further Details:      
 
Domain Number 2 Region: 506-644
Classification Level Classification E-value
Superfamily FAS1 domain 5.36e-30
Family FAS1 domain 0.0015
Further Details:      
 
Domain Number 3 Region: 1470-1518,1599-1710
Classification Level Classification E-value
Superfamily FAS1 domain 3.66e-28
Family FAS1 domain 0.003
Further Details:      
 
Domain Number 4 Region: 1712-1865
Classification Level Classification E-value
Superfamily FAS1 domain 8.5e-26
Family FAS1 domain 0.0041
Further Details:      
 
Domain Number 5 Region: 962-1118
Classification Level Classification E-value
Superfamily FAS1 domain 2.09e-21
Family FAS1 domain 0.0051
Further Details:      
 
Domain Number 6 Region: 383-496
Classification Level Classification E-value
Superfamily FAS1 domain 4.84e-21
Family FAS1 domain 0.0037
Further Details:      
 
Domain Number 7 Region: 2297-2420,2457-2485
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000000000115
Family FAS1 domain 0.011
Further Details:      
 
Domain Number 8 Region: 1137-1228
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000183
Family FAS1 domain 0.0081
Further Details:      
 
Domain Number 9 Region: 1542-1579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family Merozoite surface protein 1 (MSP-1) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007982694.1.81039
Sequence length 2593
Comment PREDICTED: stabilin-1 isoform X1 [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MAGPQGLLPLCLLAFCLAVFIRGQVLFKGCDVKTTFVTHVPCTSCAAIKKQTCPSGWLRE
LPDQITQDCRYEVQLGGSMVSMSGCRRKCRKQVVQKACCPGYWGSRCYECPGGAETPCNG
HGTCLDGMDRNGTCVCQENFRGSACQECQDPNRFGPDCQSVCSCVHGVCNRGPRGDGSCL
CFAGYTGPHCDQELPICQELRCPQNTQCSAEAPSCKCLPGYTQQGSECRAPNPCWPSPCS
PLALCSVSPKGQAQCHCSDNYHGDGIVCLPKDPCTDNLGGCPSNSTLCVYQKPGQAFCTC
RPGLVSINSNASAGCFAFCSPFSCDRSATCQVTADGKTSCVCRESEVGDGRACYGHLLHE
VQKATQTGRVFLQLRVAVAMMDQGCREILTTAGPFTVLVPSISSFSSRTMNASLAQQLCR
QHIIAGQHILEDTRTQQTRKWWTLAGQEITVTFNQFTKYSYKYKDQPQQTFNIYKANNIA
ANGVFHVVTGLRWQPPSGTPGDPKRTIGQILAATEAFSRFETILENCGLPSILDGPGPFT
VFAPSNEAVDSLRDGRLIYLFTAGLSKLQELVRYHIYNHGQLTVEKLISKGRILTMANQV
LAVNISEEGRILLGPEGVPLQRVDVLAANGVIHMLDGILLPPTILPILPKHCSEEQHKIV
AGSCVDCQALNTSTCPHNSVKLDIFPKECVYIHDPTGLNVLKKGCASYCNQTVTEQGCCK
GFFGPDCTQCPGGFSNPCYGKGNCSDGIQGNGACLCFPDYKGIACHICSNPNKHGDQCQE
DCGCVHGLCDNRPGSGGVCQQGTCAPGFSGRFCNESMGDCGPTGLAQHCHLHARCVSQEG
VARCRCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGSLGTHHCTCHKGWSGDGRVC
VAIDECELDVRGGCHADALCSYVGPGQSRCTCKLGFAGDGYQCSPIDPCRAGNGGCHGLA
TCRAVGGGQRVCTCPPGFGGDGFSCYGDIFRELEANAHFSIFYQWFKSAGITLPADGRVT
ALVPSEAAIRQLNPEERAFWLQPRMLPSLVRAHFLQSALFEEELARLGGQEVATLNPTTR
WEIRNISGRVWVQNASVDVADLLATNGVLHILSQVLLPSRGDVPGGQGLLQQLDLVPAFS
LFRELLQRHRLVSQIEAATAYTIFVPTNRSLEAQGNSSHLDADTVRHHVVLGEALSMETL
RKGGHRNSLLGPAHWIVFYNHSGQPEVNHVPLEGPMLEAPGRSLIGLSGVLTVGSSRCLH
SHAEALREKCVNCTRKFRCTQGFQLQDTPRKSCVYRSGFSFSRGCSYTCAKKIQVPDCCP
GFFGTLCEPCPGGLGGVCSGHGQCQDRFLGSGECHCHEGFHGTACEMCELGRYGPNCTGV
CDCAHGLCQEGLQGDGSCVCNVGWQGLRCDQKITSPQCPRKCDPNANCVQDSAGASTCAC
AAGYSGNGVFCSEVDPCAHGHGGCSPHANCTKVAPGQRTCTCQDGYMGDGELCQEINSCL
IHHGGCHIHAECIPTGPQQVSCSCREGYRGDGIRTCELLDPCSKNNGGCSPYATCKSTGD
GQRTCTCDTANTVGDGLTCRARVGLELLRDKHASFFSLRLLEYKELKGDGPFTIFVPHAD
LMSNLSQDELARIRAHRQLVFRYHVVGCRRLRSEDLLEQGYATALSGHPLRFSEREGSIY
LNDFARVVSSDHEAVNGILHFIDRVLLPPDALHWEPDDEPIPRRNVTAAAQGFGYKIFSG
LLKVASLLPLLREASHRPFTMLWPTDAAFRALPPDRQAWLYHEDHRDKLAAILRGHMIRN
VEALASDLPNLGPLRTMHGTPISFSCSRTRPGELMVGEDDARIVQRHLPFEGGLAYGIDQ
LLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQGSPEACWRLYPKFWTSPPLR
SLGLHSVWVQHSLWARPQGLGRGCHRNCVTTTWKPSCCPGHYGSECQACPGGPSSPCSDR
GMCMDGMSGSGQCLCRSGFAGTACELCAPGAFGPHCQACRCTVHGRCDEGLGGSGSCFCD
EGWTGSHCEVQLELQPVCTPPCAPKAVCRAGNSCECSLGYEGDGRVCTVADLCQDGHGGC
SEHANCSQVGTAVTCTCLPDYEGDGWSCRARNPCTDGHRGGCSEHADCLSTGLNTRRCEC
HAGYVGDGLQCLEELEPPVDRCLGRPPPCHSDAVCTDLHFQEKRAGVFHLQATSGPYGLN
FSEAEAACKAQGAVLASFPQLSAAQQLGFHLCLMGWLANGSAAHPVVFPVADCGNGRVGI
VSLGARKNLSERWDAYCFRVQDVACRCRDGFVGDGISTCNGKLLDVLAATANFSTFYGML
LGYANATQRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATLLSANAS
QGKLLPAHSGLSLIISDAGPDNSSWAPVVSLAAVPPCWPWPLLTMGLTLISLQAPGTVVV
SHVIVWDIMAFNGIIHALASPLLAPPQPQAVLAPKAPPVAAGVGAVLAAGALLGLVAGAL
YLRAQGKPTGFGFSAFQAEEDAADDFSPWQEGTNPTLVSVPNPVFGSDTFCEPFHDSLLE
EDFPDTQRILTVK
Download sequence
Identical sequences XP_007982694.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]