SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007985017.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007985017.1.81039
Domain Number 1 Region: 261-398
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.41e-33
Family Synaptotagmin-like (S variant) 0.00022
Further Details:      
 
Domain Number 2 Region: 121-257
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.05e-31
Family Synaptotagmin-like (S variant) 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007985017.1.81039
Sequence length 413
Comment PREDICTED: synaptotagmin-17 isoform X7 [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MASRSSDKDGDSVHTASEVPLTPRTNSPDGRRSSSDTSKSTYSLTRRISSLESRRPSSPL
IDIKPIEFGVLSAKKEPIQPSVLRRTYTPDDYFRKFEPHLYSLDSSSDDVDSLTDEEILS
KYQLGMLHFSTQYDLLHNHLTVRVIEARDLPPPISHDGSRQDMAHSNPYVKICLLPDQKN
SKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEVD
LVKGGHWWKALIPSSQNEVELGELLLSLNYLPSAGRLNVDVIRAKQLLQTDVSQGSDPFV
KIQLVHGLKLVKTKKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDF
IGRIVIGQYSSGPSESNHWRRMLNTHRTAVEQWHSLRSRAECDRVSPASLEVT
Download sequence
Identical sequences A0A0D9R650 A0A2K5HNQ2 A0A2K5XHB7 G7NPS1 G7Q0L3
ENSPANP00000015302 XP_007985017.1.81039 XP_011710305.1.29376 XP_011710306.1.29376 XP_011710307.1.29376 XP_011710308.1.29376 XP_011710310.1.29376 XP_011787244.1.43180 XP_015298074.1.63531 XP_015298075.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]