SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007985416.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007985416.1.81039
Domain Number 1 Region: 36-183
Classification Level Classification E-value
Superfamily L domain-like 1.63e-34
Family Internalin LRR domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007985416.1.81039
Sequence length 190
Comment PREDICTED: dynein light chain 1, axonemal [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCI
EKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHVMKKLKIL
YMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTP
VIKGDEEEDN
Download sequence
Identical sequences A0A096NUK0 A0A2K5LRX1 A0A2K5TPJ8 F7CEH1 G3RIT1 K7D4W5
ENSMMUP00000006520 ENSPANP00000016724 9544.ENSMMUP00000006520 9598.ENSPTRP00000011064 ENSPTRP00000011064 NP_001247523.1.72884 XP_001141594.1.37143 XP_003824195.1.60992 XP_005561782.1.63531 XP_007985416.1.81039 XP_007985418.1.81039 XP_011926171.1.92194 XP_018865404.1.27298 ENSGGOP00000015593 ENSMMUP00000006520 ENSPTRP00000011064 ENSGGOP00000015593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]