SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007988401.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007988401.1.81039
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.36e-78
Family BAR domain 0.0000000521
Further Details:      
 
Domain Number 2 Region: 284-344
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-21
Family SH3-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007988401.1.81039
Sequence length 347
Comment PREDICTED: endophilin-A3 isoform X1 [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKAVAEILSKTTEYLQP
NPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGES
MKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPD
EEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHKQSTEILQELQSKL
QMRISAASSVPRREYKPRPVKRSASELNGVSTTSVVKTTGSNIPMDQPCCRGLYDFEPEN
QGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ
Download sequence
Identical sequences A0A096NN00 A0A0D9RXK0 A0A2K5KPH8
XP_007988401.1.81039 XP_011947425.1.92194 ENSPANP00000014360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]