SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007994776.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007994776.1.81039
Domain Number 1 Region: 473-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 585-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 417-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 529-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.6e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 277-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.19e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 22-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.55e-24
Family KRAB domain (Kruppel-associated box) 0.00096
Further Details:      
 
Domain Number 7 Region: 333-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 8 Region: 165-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.98e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 207-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.62e-19
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 10 Region: 631-683
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 11 Region: 115-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-17
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 12 Region: 380-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000866
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007994776.1.81039
Sequence length 684
Comment PREDICTED: zinc finger protein 585B isoform X4 [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MPASWTSPQKSSALAPEDQGSSYEGSVSFRDVAINFSREEWRHLDPSQRNLYRDVMLETY
SHLLSVGYQVPKPEVVMLEQGKEPWALQGERPRQSCPGKNPMDVPNLERASPGTHSSRHQ
RIHTGEKLHECSECGKGFPYNSDLSIHEKIHTGERHHECTDCGKAFTQKSTLKMHQKIHT
GERSYICIECGQAFIQKTQLIAHRRIHTGEKPYECSNCGKSFISKSQLQVHQRVHMRVKP
YICTEYGKVFSNNSNLITHEKVQSREKSSICTECGKAFTYRSELIIHQRIHTGEKPYECS
DCGKAFTQKSTLTVHQRIHTGEKSYVCMKCGLAFIRKAHLVTHQIIHTGEKPYKCGHCGK
LFTSKSQLHVHKRIHTGEKPYMCNKCGKAFTNRSNLITHQKTHTGEKSYICSKCGKAFTQ
RSDLITHQRIHTGEKPYECSTCGKAFTQKSHLNIHQKIHTGERQYECHECGKAFNQKSIL
IVHQKIHTGEKPYVCTECGRAFIRKSNFITHQRIHTGEKPYECSDCGKSFTSKSQLLVHQ
PIHTGEKPYVCAECGKAFSGRSNLSKHQKTHTGEKPYICSECGKTFRQKSELITHHRIHT
GEKPYECSDCGKSFTKKSQLQVHQRIHTGEKPYVCAECGKAFSNRSNLNKHQTTHTGDKP
YKCGICGKGFVQKSVFSVHQSSHT
Download sequence
Identical sequences XP_007994776.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]