SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007994827.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007994827.1.81039
Domain Number 1 Region: 228-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 340-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 3 Region: 396-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 453-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.16e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 172-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 564-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 7 Region: 508-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 117-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 62-118
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.49e-18
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 10 Region: 4-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-17
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 11 Region: 611-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.46e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 12 Region: 270-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000327
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007994827.1.81039
Sequence length 663
Comment PREDICTED: zinc finger protein 607 isoform X3 [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MACESITFGDVAIDFSHQEWEYLNLVQKTLYQEVMMENYDNLVSLDLDSRCEIISDGKMH
LYRKHSSVTLHQRIHNGQKPYECKECQKAFSHLTELIVHQRIHTSEEPDQCEEFGKAFSH
LTDLREHQKIHAREKPYECEECGKVFSYPANLAQHGKVHVEKPYKCKECGEAFRTSRQLT
VHHRFHYGEKPYECKECGKAFSVYGRLSRHQSIHTGEKPFECNKCGKSFRLKAGLKVHQS
IHTGEKPHECKECGKAFRQFSHLVGHKRIHTGEKPYECKECGKGFTCRYQLTMHQRIYSG
EKPYECKDNGEAFSSGHQLTAPHTFESVEKPYKCEECGKAFSVYGRLTRHQGIHSGKKPF
ECNKCGKSFRLNSSLKIHQNIHTGEKPYKCKECGKAFSQRAHLAHHNRIHTGYKPFECKE
CGKSFRCASYLVIHERIHTGEKPYICQECGKGFSYSHKLTIHRRVHTGEKPYECKECGKA
FSVSGQLTQHLSIHSGKKPFECNKCGKSFRFISVLKAHQNIHSAEKPYECKECGKAFRHA
TSLIYHDRTHAGEKSYECKECGETFSHASHLIIHERIHTSDKPYECKRCGKAFRCASYLL
RHERVHADGNPYMCEECGKAFNSSHELSIHHRVHTGEKPFKCNKCRRSFRLRSILEVHQR
IHI
Download sequence
Identical sequences XP_007994827.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]