SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008001255.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008001255.1.81039
Domain Number 1 Region: 20-141
Classification Level Classification E-value
Superfamily Lysozyme-like 8.13e-47
Family C-type lysozyme 0.000000372
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008001255.1.81039
Sequence length 142
Comment PREDICTED: alpha-lactalbumin [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MRSFVPLFLVGILFPAIPAKQFTKCELSQLLKDIDGYGGIALPEFICTMFHTSGYDTQAI
VESNGSTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGI
DYWLAHKALCTEKLEQWLCEKL
Download sequence
Identical sequences A0A096MPC1 A0A0D9R1R6 A0A2K6CC25 F6X0Y7 G7PHQ9
9544.ENSMMUP00000000385 ENSMMUP00000000385 XP_001102116.1.72884 XP_005570769.1.63531 XP_008001255.1.81039 XP_011758581.1.29376 ENSPANP00000001573 ENSMMUP00000000385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]