SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008002445.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008002445.1.81039
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily DEATH domain 2.77e-23
Family Caspase recruitment domain, CARD 0.00000869
Further Details:      
 
Domain Number 2 Region: 110-191
Classification Level Classification E-value
Superfamily DEATH domain 1.84e-19
Family DEATH domain, DD 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008002445.1.81039
Sequence length 199
Comment PREDICTED: death domain-containing protein CRADD [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
METRDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHVQEINAQTTGLRKTMLLLDI
LPSRGPKAFDTFLDSLQEFPWVREKLKKARKEAMTDLPAGDRLTGIPSHILNSSPSDRQI
NRLAQRLGPEWEPVVLSLGLSQTDIYRCKANHPHNVQSQVVEAFVRWRQRFGKQATFQSL
HNGLRAVDVDPSLLLHMLE
Download sequence
Identical sequences XP_008002445.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]