SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008008878.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008008878.1.81039
Domain Number 1 Region: 169-363
Classification Level Classification E-value
Superfamily E set domains 1.17e-79
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000852
Further Details:      
 
Domain Number 2 Region: 63-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.34e-24
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008008878.1.81039
Sequence length 433
Comment PREDICTED: ATP-sensitive inward rectifier potassium channel 12 [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANM
DEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGVIFWVIAVVHGDLEPAEGRGR
TPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAI
MAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE
GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE
GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAK
DLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGSG
ALEQRPYRRESEI
Download sequence
Identical sequences A0A0D9S9A5 A0A2K5KTW1 F7GLZ2 G7PTV6
ENSMMUP00000014304 XP_001104273.1.72884 XP_005583207.1.63531 XP_008008878.1.81039 XP_008008879.1.81039 XP_011759163.1.29376 XP_011932645.1.92194 XP_011932646.1.92194 XP_015293269.1.63531 9544.ENSMMUP00000014304 ENSPANP00000009116 ENSMMUP00000014304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]