SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008009286.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008009286.1.81039
Domain Number 1 Region: 22-146
Classification Level Classification E-value
Superfamily Lysozyme-like 4.5e-45
Family C-type lysozyme 0.0000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008009286.1.81039
Sequence length 148
Comment PREDICTED: lysozyme-like protein 6 [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MTKVLLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNIS
KINENADGSFDYGLFQINGHYWCNDYRSHSENLCQVDCQDLLNPNLLAGIHCAKRIVSGA
RGMNNWVEWRLHCSGRPLSYWLTGCRLG
Download sequence
Identical sequences A0A096P3Y6 A0A0D9R1L4
ENSPANP00000020061 XP_008009286.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]