SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008015869.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008015869.1.81039
Domain Number 1 Region: 1123-1299
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.0006
Further Details:      
 
Domain Number 2 Region: 685-800
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.01e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 3 Region: 877-1038
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-24
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 4 Region: 450-572
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-24
Family Pleckstrin-homology domain (PH domain) 0.0000113
Further Details:      
 
Domain Number 5 Region: 1433-1570
Classification Level Classification E-value
Superfamily PH domain-like 1.82e-19
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 6 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.77e-17
Family SAM (sterile alpha motif) domain 0.0000298
Further Details:      
 
Domain Number 7 Region: 586-684
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000308
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 8 Region: 1015-1109
Classification Level Classification E-value
Superfamily PH domain-like 0.000000225
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008015869.1.81039
Sequence length 1703
Comment PREDICTED: arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 isoform X1 [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MSSVSEVNVDIKDFLMSINLEQYLLHFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRI
LNQLQIILSKMQDFPIYANVHKTKKNDDPSKDHTVPSSDHNICIELSSSSSVQTPSPPQL
ETVTKKLEEDASVERSQYPQSDNKLSPPKRDFSTAEEPHLNLGSLNDSLFGSENIKIESL
ITKKTMDHTIEEQQTEKVKLISENLNKLPNADSECLSSVGCSTSETNSRNGTNGLLDGSP
PSPFFKFQGEMIVNDLYVPSSPILAPMRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGISG
SYFRERRNVATSTEKSVAWQNSNEENSSSIFPYGETFLFQRLENSKKRSIKNEFLTQEEA
LKGEATTATNSFIIKSSIYDNRKEKISEDKVEDIWIPREDKNNFLIDTASESEYSTVEEC
FQSLRRKNSKASKSRTQKALTLDSVNRHSYPLSSTSGNADSSAVSSQAISPYACFYGASV
KKVKSGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAISTVRVQGDN
KFEVVTTQRTFVFRVEKEEERNDWISILLNALKSQSLTSQSQGIVTPEKCGYLELRGYKA
KIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFTA
ETEKEKQDWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICK
KCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMDS
PVEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCA
TGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGVLSQESSQSTFLCDFLYQ
APAAASKLSSEKKLLEETNKKWCVLEGGFLSYYESDKSTTPNGTININEVICLAIHKEDF
YLNTGPIFIFEIYLPSERVFLFGAETSQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQL
FYKDCHALDQWRKGWFAMDKSSLHFCLQMQEVQGDRMHLRRLQELTISTMVQNGEKLDVL
LLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQ
YGLGCKYIYQNNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTGVLKSFLSDIDDALL
TKELYPYWISALDAQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMNA
HNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQ
VSQAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEVIE
NEELERPLHYKENVLEQVLRWSSLAEPGSAYLVVKKFLTADTIKHCSDRSTLGSIKEGIL
KIKEEPSKILSGNKFQDRYFVLRDGFLFLYKDVKSSKHDKMFSLSSVKFYRGVKKKMKPP
TSWGLTAYSEKHHWHLCCDSSRTQTEWMTSIFIAQHENDIWPPAGKERKRSITKNPKIGG
LPLIPIQHEGNATLARKNIESARAELERLRLIEKCDKESVDSSLKERASMVAHCLEHKDD
KLRNRTRKHRSFNCLEDTEPEAPLGQPKGHKGPKTLRKTEDRNSKATLDSDHKLPSRVIE
ELNVVLQRSRTLPRELQDEQILK
Download sequence
Identical sequences A0A0D9RW49
XP_008015868.1.81039 XP_008015869.1.81039 XP_008015870.1.81039 XP_008015871.1.81039 XP_008015872.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]