SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008032079.1.43472 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008032079.1.43472
Domain Number 1 Region: 116-242
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000154
Family Glutathione S-transferase (GST), C-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 4-122
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000937
Family Glutathione S-transferase (GST), N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008032079.1.43472
Sequence length 260
Comment hypothetical protein TRAVEDRAFT_41340 [Trametes versicolor FP-101664 SS1]; AA=GCF_000271585.1; RF=representative genome; TAX=717944; STAX=5325; NAME=Trametes versicolor FP-101664 SS1; strain=FP-101664 SS1; AL=Scaffold; RT=Major
Sequence
MTTTPQRIALYGSPHSPFVARVRLALEEAQADYHTVFFDLDERPQWFFDNVNSAGKVSIS
TPQFNLAPPRPELTACSRDQVPTIVYRSSPDAPPEKPTPESAKIAESLVLLEFVADLHPN
ANLLPRDPVLRAKARLFIRKLDEKFQSAFLALLFDKDGGAEVLELLVELQNELPPTGYVV
GDWSIADAAFVPMVAAVGIVAKTGRGYFRDVDGGKLTQELAAPRFERLREYMRINKERPS
FDEFVAIKWVKRFAKPADKK
Download sequence
Identical sequences jgi|Trave1|41340|gm1.224_g XP_008032079.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]