SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008034402.1.43472 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008034402.1.43472
Domain Number 1 Region: 80-219
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.53e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 5-89
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.73e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008034402.1.43472
Sequence length 231
Comment glutathione S-transferase C-terminal-like protein [Trametes versicolor FP-101664 SS1]; AA=GCF_000271585.1; RF=representative genome; TAX=717944; STAX=5325; NAME=Trametes versicolor FP-101664 SS1; strain=FP-101664 SS1; AL=Scaffold; RT=Major
Sequence
MSSRKQFTLHGDVTGPNPLKVAVVLEELGLEYDIVNINVRTGEHKNPEYLKLNPNGRVPT
LVDHSNGDFTIWESDAILLYLVENYDKEHKLSVADVHEKFKLIQWLFFQASGQGPYFGQA
VWFMRYHHERLPSAIERYQKEILRVLGVLETVLSKQEWLVGGKLTVADISFITWNQMAIG
WGLEGVEGGDVQKEFPNVYKWHQKLVSRPIVRKFLDMQAETFRKFSESQAK
Download sequence
Identical sequences jgi|Trave1|114024|e_gw1.2.1280.1 XP_008034402.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]