SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008035470.1.43472 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_008035470.1.43472
Domain Number - Region: 199-262
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0408
Family Glutathione S-transferase (GST), C-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008035470.1.43472
Sequence length 320
Comment hypothetical protein TRAVEDRAFT_69872 [Trametes versicolor FP-101664 SS1]; AA=GCF_000271585.1; RF=representative genome; TAX=717944; STAX=5325; NAME=Trametes versicolor FP-101664 SS1; strain=FP-101664 SS1; AL=Scaffold; RT=Major
Sequence
MSFDPSDPIPGTRVEYIAVVASMGLYGITCMQTFMYYANQRKGGDRWPIHILVAFLWAMD
TTHQIITNRGFWVLISRVHDPFILSKEYLWAGLFTSLVTLPTQLFFVMRIWRISKKNWFV
PLIFVPCSLFQFGGYIAFLVLCLNGGPTAEIIYVIRKLPMAFWGVGAAEDVLISMCLVYL
LWHNRDRGGFRSTERLIYRLTVFAINTGMWTSMCALFVIITMAAYPQIQTYVALYLVVCP
LYCNTLLANLNGRSYIRGDDFTEPISLLGPSQGRIAFTSFPSTGPPISQETTMTLRDLPV
PSHSNNSSLKLEKVMKHDEV
Download sequence
Identical sequences XP_008035470.1.43472 jgi|Trave1|69872|estExt_Genemark1.C_3_t10401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]