SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008036759.1.43472 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008036759.1.43472
Domain Number 1 Region: 189-501
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.97e-87
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000307
Further Details:      
 
Domain Number 2 Region: 496-694
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 7.85e-49
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.00083
Further Details:      
 
Domain Number 3 Region: 88-154
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000292
Family Glutathione S-transferase (GST), C-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008036759.1.43472
Sequence length 781
Comment glutamate-tRNA ligase [Trametes versicolor FP-101664 SS1]; AA=GCF_000271585.1; RF=representative genome; TAX=717944; STAX=5325; NAME=Trametes versicolor FP-101664 SS1; strain=FP-101664 SS1; AL=Scaffold; RT=Major
Sequence
MSGVLTLTPAASPFPWAAAAISTYTSKATLNFDTAAKGVTLEIDGSQITAEDEIVQALAK
AGGLADDSAKTAAYFALAKTLPTVTAFPEITAALDSLDDHLAYRTFLVGHDITAAEWIVW
GALKGSVKIVGLLKNNKHPHLLRWFNHLESLESTQLAIAGLTEAKSAKARNNKTAASFAL
GLQDAKEGQVVTRFPPEPSGYLHIGHAKAAMLNQYFAKMYKGKMIIRFDDTNPSKERTEF
EETILEDLALLDVHGDRITHTSDYFEELYNYALQAIKSGKAYADDTEQEQMRKERWDGIA
SKHRDDSVEDNLKHFAEMTTGSAEGIRWCLRAKMSVDNPNKALRDPVIFRTNLLPHHRTG
DKWKVYPTYDFACPIVDSLEGVTHALRTNEYRDRNPQYHWMIEALNLRPVNIWDFSRLNF
IYTLLSKRKLHWFVDTGLVRGWDDPRFPTVRGIRRRGLTIEALRQFMLAQGPSQAVVSLE
WDSLWTLNKKVIDPVAPRFWALSETNIVPVTVKGGPETAEIKSLPKHKKNPEVGEKQTVY
SSQIFIEQEDAISLEDNEEFTLMDWGNAIVRSKTVDASGIITGLELDLHLAGDFRKTKKK
ITWLAQPTSAAPLIDVTLLDYDYLITKKKLEEADAVKDFVTPVTEFRELARADANVRTLV
KSDIIQFERKGYYIFDGVSKEDGRLEFIRIPDGRAASIASKAAPQTGAATPVPKGAATPV
GAPAQKAEADEQRGQLSSLETPVDTKMYKVGVVYGEGEVPTPADTKMYKVQSVYGVKPES
A
Download sequence
Identical sequences XP_008036759.1.43472 jgi|Trave1|70818|estExt_Genemark1.C_4_t10450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]