SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008039329.1.43472 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008039329.1.43472
Domain Number 1 Region: 6-118
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.55e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 90-231
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000000016
Family Glutathione S-transferase (GST), C-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008039329.1.43472
Sequence length 240
Comment thioredoxin-like protein [Trametes versicolor FP-101664 SS1]; AA=GCF_000271585.1; RF=representative genome; TAX=717944; STAX=5325; NAME=Trametes versicolor FP-101664 SS1; strain=FP-101664 SS1; AL=Scaffold; RT=Major
Sequence
MSSTKQITLYTATFSPYAHRVRIALEEAGAEYTTYDVDILRNMPDWFPLVNPLKKIPAMT
FGGPEVPPDQPSPESAKIAESLAMLEFIADLFPDAKLLPTDPVLRARARTFMALYENYVN
GQFRDVWFLGTPADPLLQALEMLQGALPPDGGFAAGEWSIADAAVIPFLARMFPYLEAGL
GLYSKEDGVKMRKAMASERFARIRQYVRDCRARPSFANTWAGDAEQVEAAKTVPMLRVGE
Download sequence
Identical sequences jgi|Trave1|48691|gm1.7575_g XP_008039329.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]