SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008041620.1.43472 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008041620.1.43472
Domain Number 1 Region: 222-310
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000291
Family Thioltransferase 0.062
Further Details:      
 
Domain Number 2 Region: 460-502,539-576
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000558
Family UBX domain 0.045
Further Details:      
 
Weak hits

Sequence:  XP_008041620.1.43472
Domain Number - Region: 8-50
Classification Level Classification E-value
Superfamily UBA-like 0.0479
Family UBA domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008041620.1.43472
Sequence length 607
Comment hypothetical protein TRAVEDRAFT_60129 [Trametes versicolor FP-101664 SS1]; AA=GCF_000271585.1; RF=representative genome; TAX=717944; STAX=5325; NAME=Trametes versicolor FP-101664 SS1; strain=FP-101664 SS1; AL=Scaffold; RT=Major
Sequence
MDVDSLTPTQKAAFDQLQALTDGGDPEVAIGVLASVGWDVQRAAEVVFDGGAPPPPAPAP
AQQAPPMEQFELDDSEQGLLSGRRGGREFRQVESNSFSSLVARPIRLVFNIIAIPLYPLF
SLIRFIFRAFRIPLPNFTFSTLSYRPLGPSHGREAKDPKSVAERWVLTLEEETGAVCLSR
SGQRRSNGSGQPSATGIAGPSNVTARGNAWDETTSDRDVKLLPDFFLGSYEEFARMCQRD
SKIGCIVIVSEEHDDVAEFKRSTLTDPSFVRLIQENEILVWGGDIRDKEAWSASQKLQAT
TYPFVAFIALQSRRAPASAAPPAPTMTILSRHQGPSIPSTSAPTAAQTLVKHLTEQLLPR
VTPFLNQLRAQEAERDRERALRAEQDRAFEESRRRDADRIQQRAREERAAAEERQRTADA
EARAAEERRKAAEAKKQWVAHRMAWRRWIRRGLVVREPRPGETGRGKTLRVGVRMPDGRR
VVRFFGENDAVTALYAYVDSLFIPPEFIQDADPPTPPEGGAVGEQGLIGEMVASGKPAEK
WWGFKIVLAYPRREIVWEAEKRVGDIDVLKGGGQVVVELVADESDAKGKHKAVAESAEDD
EYHTESD
Download sequence
Identical sequences jgi|Trave1|60129|estExt_fgenesh1_pm.C_9_t10441 XP_008041620.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]