SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008049996.1.4292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008049996.1.4292
Domain Number 1 Region: 422-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.39e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 535-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-23
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 478-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 255-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.25e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 5 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-21
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 2-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.41e-21
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 7 Region: 591-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.35e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 143-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 199-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 10 Region: 311-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 11 Region: 636-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 12 Region: 89-143
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000239
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008049996.1.4292
Sequence length 689
Comment PREDICTED: zinc finger protein 260-like, partial [Carlito syrichta]; AA=GCF_000164805.1; RF=representative genome; TAX=1868482; STAX=1868482; NAME=Carlito syrichta; AL=Scaffold; RT=Major
Sequence
GSLSFEDVAVYFTREEWQLLDPTQKVLYKEVMLENYGNLVSVGFIILNRHFAEKDYDDFS
GYGKSCLHMKHDITLTGLKYHRCVNPSNTKSQLNDYHKTYTGEKPYECSEGGKAFSRKAQ
LIRHQRSKRGEKPCRCHECGKIFMRNIQLIEHQRTHRGEKPHENNECEKAFSRMSLLMVH
QRTHTGEKLYQCSKCGKGFNCKSKLSRHQQSHTGEKPYGCSVCGKTFSRKEYITIHQRLH
TREKLYECTECGKGFLQKASLTVHQRLHTGEKPYECTVCGKAFSHKICLTLHQTVHTVDK
PYECTECGKGFAIKGYLTRHQRGHRGQKPYECTECGKGFSQKTYHTIHQRLHTGEKAYEC
SECGKAFSKKTDLVSHQRTKRGEKPHGCNECGKSFKWKMELIKHQRTHTGEKPYECTECG
KAYSQKVFLTVHQRLHTGERPYECTECGKAFSQKRYLTEHQRIHTGEKPYKCTECGKSFS
RRSYLTLHKRLHTGEKPYACNECSKTFKSKTQLINHLRTHTGERPYSCSECGKNFRSKSN
LSGHQRSHTGEKLYECSVCGKAFSQKVSLTAHQKLHTGENPYECSECGKGFASKVQLVRH
QTTERGEKPHRCDECGKTFMRKRQLTEHQRTHTGEKPYECNECNRAFRCKSQLTEHLQTH
TGERPYTCSECGKGFSRRFQLTRHQRSHT
Download sequence
Identical sequences A0A1U7T828
XP_008049996.1.4292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]