SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008069552.1.4292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008069552.1.4292
Domain Number 1 Region: 46-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.24e-39
Family SCAN domain 0.0000675
Further Details:      
 
Domain Number 2 Region: 640-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.97e-27
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 528-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.23e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 682-734
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-21
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 8 Region: 378-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-20
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 9 Region: 225-285
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000068
Family KRAB domain (Kruppel-associated box) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008069552.1.4292
Sequence length 751
Comment PREDICTED: zinc finger protein with KRAB and SCAN domains 7 [Carlito syrichta]; AA=GCF_000164805.1; RF=representative genome; TAX=1868482; STAX=1868482; NAME=Carlito syrichta; AL=Scaffold; RT=Major
Sequence
MTTEGRGTLGLIPRSAAFQKLEGRLTVKQEPGNQTWSQGCSLQKNHPPVCEIFRLHFRQL
CYHEMSGPQEALSRLRELCHWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPE
SGEEAVAVVEDFQRHLSGPGEVSAPAQEQEMHLEETMALGATKESPPTSPINGGSAPGAH
LKSPHDPGAHHLSNGHFAQLASQVPALPQAGNSGYQVEASILQMVRPQDTAAYEDLSVDY
TQKKWKGPALSQKALYRNMMPENYHSMVSLADANMMEHSVLTLKQKMSKGSLSSDRTSGG
LFGVAPGKPEPGDVSQDTFKKLEEAPIDEEGSRLESDLLEITEKDKKKSIKDRCKENREH
PNLSSSSVEYEGILKGQKSYQCDECGRAFNRSSHLIGHQRIHTGEKPYECNECGKTFRQT
SQLIVHLRTHTGEKPYECKECGKTYRHSSHLIQHQRLHNGEKPYKCNECAKAFTQSSRLI
DHQRTHTGEKPYECIECGEAFIRSKSLVRHQVLHTGKKPYKCDECGRAFCSNRNLIDHQR
IHTGEKPFECHECGKAFSRSKCLIRHQSLHTGEKPYKCSECGKAFNQNSQLVDHERIHTG
EKPFECSECGKAFGLSKCLIRHQRLHTGEKPYKCNECGKSFNQNSHLIIHQRIHTGEKPY
ECNQCGKVFSYSSSLMVHQRTHTGEKPYKCNDCGKAFSDSSQLIVHQRVHTGEKPYECSE
CGKAFSQRSTFNHHQRTHMGDKPSGLARSVS
Download sequence
Identical sequences A0A1U7UW10
ENSTSYP00000005668 XP_008069552.1.4292 ENSTSYP00000005668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]