SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008102075.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008102075.1.98722
Domain Number 1 Region: 69-512
Classification Level Classification E-value
Superfamily Sema domain 1.57e-109
Family Sema domain 0.00012
Further Details:      
 
Domain Number 2 Region: 1407-1534,1724-1910
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-42
Family p120GAP domain-like 0.045
Further Details:      
 
Domain Number 3 Region: 874-969
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000318
Family Other IPT/TIG domains 0.035
Further Details:      
 
Domain Number 4 Region: 966-1054
Classification Level Classification E-value
Superfamily E set domains 0.000000000000056
Family Other IPT/TIG domains 0.028
Further Details:      
 
Domain Number 5 Region: 515-566
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000144
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 6 Region: 1054-1098,1135-1188
Classification Level Classification E-value
Superfamily E set domains 0.000000322
Family AMPK-beta glycogen binding domain-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008102075.1.98722
Sequence length 1943
Comment PREDICTED: plexin-B3 isoform X1 [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MSSSLKVSLLRDVRGALRLLPLPDVTMRELKCSQRGQRDWTMSLGHLLLSPVVVVTLLLP
LYSAARPPSYPSFLAPNATFNHLAQAQNTGALYVGAINALYQLSPELRLVGLARTGPDQD
SPECLPFRDARECPQARLTDNSNKLLLTNERAGELVVCGQLFQGVCEKRALADIAKVLYR
PEDPGDNQFVAANEPRVSTVGLLGRHGGRDLLFVGRGLTAKLSGGIPPFTIRQLEGAQAF
SNEGMGKLVVGDFSDYNNSYVGAFASDGYVYFLFSRRGAKAQMEYRTYLSRSCMEDTNLY
SYVELPLECQDAKGRIYNLAQAVHLAPGYAGQGKTLFVVLAAGQGSTAAPTTQTALCLYS
LRDVDEAMERTRQLCYTSAGIGPTKEEEAAIEYGVTSRCNSLPKESPEAYPCGDEHTPSP
IASRKPLVAEALLTTVPSLTAVAAMVEAGHTIAFLGDGVGQLHKVYLNGSAAQVYSTIPT
GQRSPVNPDLLLDTSGAYLYVMTTFQVSKVPVSECPHFQDCASCLRARDPFCGWCVLQSR
CTRKLECERHEMSNHWLWSYGVDTQCLRVEQMSPANQSREEQTEVSLLIPHLPALAEGES
YHCAFGTQDSPAQLQDSWVRCLSPVPQQVPPNQEGKDHVTVALALMFRDVVVTSVGFSFY
NCNAVSQLADATPCGTCVDSPWMCHWCPSSHHCIPGGPCPKGERLVYNQKVLTEELRGAA
ACPSVGSIGEGHLIPAGVEMPLNLVAWNLPLLMGPITISCVLEVEGSPVLVPATLEEGDR
GISHRVQCLPQAYSYTQPVSELHVPLYILVGNDQRLDSRGDLHVTLYNCSAGRSDCSRCK
AAPPHFRCVWCPSKEVPGCVYEELCPTKTVSVACPSPVIHSIYPLSGPLEGGISLTVTGS
NLGHRFEDVAQTVTVAGLTCIPDPSQYLVSTRIICDVSPGRRGLSGPVEVTVGDQPPGIS
GSYFTYQDPTLLDLHPKLGPMGGGTRITITGKELATGTEIAAYVGDLPCIIEEPVEPGAI
VCRTSASSRPQEAQVWIQYGGVRRQLQEKAFHYMLNPHLTGAFPSSSFQGGGRIIYVEGT
NLDVVQQPLIKAILQPEEVKNRRKKRTCGTFLGSHVPLTPAPPRPCAEVGDLLECWETCC
INSSTLLLCPSPAIPSNAQFRNLIFEMDGLRVPFSNASEGHDFSYHPNPHLRWPGRDSSG
RPFSLKPGNILDIEGEGLNLGISKNEVRVIIGNSACIIKTLTPTNLYCEPPLLPPQPLNA
SSVLPEFMVQMGNLRLDLGRVRYDTEPPSRFPPEAQIGLGVGAAVLAFVVLLLILMYRRK
SKQALRDYKKVLVQLENMEISVGDQCRKEFTDLMTEMTDLSGELEGSGIPFLDYNTYTQR
VFFPAQGDVPLRRVLDLPEGRRATVEQGLGQLSNLLNSKVFLLTLIRTLEAQPTFSQRDR
CHAASLLSLALHGRLEYLTDIMQTLLSDLAAHCVSRNPKLMLRRTETMVEKLLTNWMSIC
LYSYLREVAGEPLYMLFRAIKYQVNKGPVDAVTGKAKRTLNDGRLLREDVEYRPLTLTVL
VRGAGPSGGSETQRIPVRVLDTDTITQVKEKILDQVYKGVPFSQRPSVHSLDLEWRSGVA
GHLTLSDEDLTSVTQKEWKRLNTLQHYKVPDGATVGLIPRLHNDISQGTGQSFFSGENTP
MLEDGEEGGVRLWHLVKPSEEPEPTKQQQDRRSSLRERAKAIPEIYLTRLLSMKGTLQKF
VDDAFQAVLSVNRPVPIAVKYLFDLLDELAVQHGVNEPETLHIWKTNSLLLRFWVNTLKN
PQFIFDVRVSDNVDANLSVIAQTFIDACTTAEHKVGRDSPVNKLLYAREIPHYKQMVEKY
YADIRQTVPASYQEMNSALTELSGKYSSDLNCLVALQELYNYINKYYDQIIFALEEDPLG
QKMQLAYRLQQIAALVENKVTDL
Download sequence
Identical sequences XP_008102075.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]