SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008106394.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008106394.1.98722
Domain Number 1 Region: 268-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000156
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 907-959
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000487
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 403-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000765
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 743-789
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000143
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 5 Region: 964-1013
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000141
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 781-839
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000797
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 7 Region: 874-915
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000372
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Weak hits

Sequence:  XP_008106394.1.98722
Domain Number - Region: 310-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000143
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number - Region: 11-35,113-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00336
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number - Region: 1041-1072
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0894
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008106394.1.98722
Sequence length 1241
Comment PREDICTED: zinc finger protein ZFAT isoform X1 [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MEGPSTGNKSIFMCKLCNLFSPNQSELLSHVSEKHSEEGIKVDDIIIPLRPLTTPSNLNK
NGEELLVVKRKRGRPKGSTKKCYVDEELAESSNCPPNEDVPPGPEEAGGQGEVPPDSLEC
RKCNRKFSNSRQLRKHICILVKPEDTEEGDPGNDSDVDLDRREDEREKAPKRQRLQRSEK
SLSAKDTDQVSGAKNPIISVVLTAHEAIPGATKIVPVEAASSKTEQLTNPETVVSDSSQR
RGYQEYAIQQTPYEQPMKSNRLSATQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKC
SFCSYASAIKANLNVHLRKHTGEKFACDYCPFTCLSKGHLKVHVERVHKKIKQHCRFCKK
KYSDVKNLIKHIKEAHDLQDKKVKEVFDELRLMTREGKRQLLYDCHICERKFKNELDRDR
HMLVHGDERPFACELCGHGATKYQALELHIRKHPFVYVCSKCLKKFVSSIRLRSHIKEAH
RDLPEASLFNSSINQSFCLLEPGGDIQQEALGEELSQTAAELSLLNSKELCILKKPVCTS
DLNAVEGSQHDNSGVKDKTTSSPALDLEAPPVADTADALCSSSTELVSPDAFPDSVPDGF
LQKDASSELAEERILLEKEGEVFPDPSQNTHNEVIPLSGEGGANINVNGQVPQCAPDVEE
SGQTICLNTQEADVATTEEVETTVQLPASESSAAVVDKSDFCPASSENRTGAAAFMQILD
SLQKRQMNTALCEKIRKVYGDLECEYCGKLFWYQVHYDMHVRTHTREHLYYCSQCSYSSI
TKNCLKRHVIQKHSNILLKCPTEDCDYSTPDKYKLQAHLKVHTDLDKKSYSCPVCDKSFS
EDRLIKSHIKTNHPEVSMNTISEIVGRRVQLKGLIGKRAMKCPYCNFYFMKNGSDLQRHI
WAHEGIKPFKCSLCEYATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHT
ADGKQFKCTVCDYTAAQKPQLLRHMEQHASFKPFRCAHCHYSCNISGSLKRHYNRKHPYE
EYVNAGSGELPTEALLQQGGIKCPVCNFVYGTKWECNRHLKNKHGLRLVERDGEMKWEQT
TEISDEETSSYLQITEAGDMQGAQAAVAALQDLRHTSENGGRFDPTAVNILQQIIELGSE
PHDATAVASVVAMAPGTVTVVKQVTEEEQPTSHTVMIQESLQQASVELTEEHHLVVSSDD
MEGLGTVTVYTQGGEASELIVYVQEAMQAVGEQAEEQEPSI
Download sequence
Identical sequences G1KLS0
ENSACAP00000011770 XP_003219437.1.98722 XP_008106394.1.98722 XP_008106395.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]