SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008106397.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008106397.1.98722
Domain Number 1 Region: 256-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000149
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 895-947
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000486
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 731-777
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000146
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 4 Region: 391-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000212
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 952-1001
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000142
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 769-827
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000797
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 7 Region: 862-903
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000498
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008106397.1.98722
Sequence length 1229
Comment PREDICTED: zinc finger protein ZFAT isoform X2 [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MCKLCNLFSPNQSELLSHVSEKHSEEGIKVDDIIIPLRPLTTPSNLNKNGEELLVVKRKR
GRPKGSTKKCYVDEELAESSNCPPNEDVPPGPEEAGGQGEVPPDSLECRKCNRKFSNSRQ
LRKHICILVKPEDTEEGDPGNDSDVDLDRREDEREKAPKRQRLQRSEKSLSAKDTDQVSG
AKNPIISVVLTAHEAIPGATKIVPVEAASSKTEQLTNPETVVSDSSQRRGYQEYAIQQTP
YEQPMKSNRLSATQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKCSFCSYASAIKAN
LNVHLRKHTGEKFACDYCPFTCLSKGHLKVHVERVHKKIKQHCRFCKKKYSDVKNLIKHI
KEAHDLQDKKVKEVFDELRLMTREGKRQLLYDCHICERKFKNELDRDRHMLVHGDERPFA
CELCGHGATKYQALELHIRKHPFVYVCSKCLKKFVSSIRLRSHIKEAHRDLPEASLFNSS
INQSFCLLEPGGDIQQEALGEELSQTAAELSLLNSKELCILKKPVCTSDLNAVEGSQHDN
SGVKDKTTSSPALDLEAPPVADTADALCSSSTELVSPDAFPDSVPDGFLQKDASSELAEE
RILLEKEGEVFPDPSQNTHNEVIPLSGEGGANINVNGQVPQCAPDVEESGQTICLNTQEA
DVATTEEVETTVQLPASESSAAVVDKSDFCPASSENRTGAAAFMQILDSLQKRQMNTALC
EKIRKVYGDLECEYCGKLFWYQVHYDMHVRTHTREHLYYCSQCSYSSITKNCLKRHVIQK
HSNILLKCPTEDCDYSTPDKYKLQAHLKVHTDLDKKSYSCPVCDKSFSEDRLIKSHIKTN
HPEVSMNTISEIVGRRVQLKGLIGKRAMKCPYCNFYFMKNGSDLQRHIWAHEGIKPFKCS
LCEYATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHTADGKQFKCTVCD
YTAAQKPQLLRHMEQHASFKPFRCAHCHYSCNISGSLKRHYNRKHPYEEYVNAGSGELPT
EALLQQGGIKCPVCNFVYGTKWECNRHLKNKHGLRLVERDGEMKWEQTTEISDEETSSYL
QITEAGDMQGAQAAVAALQDLRHTSENGGRFDPTAVNILQQIIELGSEPHDATAVASVVA
MAPGTVTVVKQVTEEEQPTSHTVMIQESLQQASVELTEEHHLVVSSDDMEGLGTVTVYTQ
GGEASELIVYVQEAMQAVGEQAEEQEPSI
Download sequence
Identical sequences XP_008106396.1.98722 XP_008106397.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]