SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008109539.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008109539.1.98722
Domain Number 1 Region: 223-250,277-485
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.94e-61
Family Voltage-gated potassium channels 0.00051
Further Details:      
 
Domain Number 2 Region: 96-193
Classification Level Classification E-value
Superfamily POZ domain 1.6e-26
Family Tetramerization domain of potassium channels 0.00000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008109539.1.98722
Sequence length 573
Comment PREDICTED: potassium voltage-gated channel subfamily A member 5 [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MEIALVTLENGGATAVGGEADSGPCGAESEALSPGRRPRHCPRPEEGMAIPGSDCPAYRA
CPSAAPAEGGGPCGGPCGGGEELGEAECESALMGQQRVLINISGLRFETHLGTLSQFPDT
LLGDPEKRMRYFDPLRNEYFFDRNRPSFDGILYFYQSGGKLRRPVNVSIDVFADEIRFYQ
LGEEAMERFREDEGFIKEEERPLPANEFQRQVWLIFEYPESSSSARGIAIVSVLVILISI
ITFCLETLPEFRDERELHVPLPLLPNGTLGDLPRPQHPSTLSDPFFIIETTCVIWFTFEL
LVRFFACPSKPEFSRNIMNIIDIVAIIPYFITLGTELAHEQQKEEQLGSTGNGGQQQAMS
LAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFA
EADDPESHFSSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVI
VSNFNYFYHRETDHEEQAMLKDESSAPGNSATDLKRQASKTSLDKSVVHLENAEGMNNVM
RSVEKANIKAKSSIDLRRSLYALCLDTNRETDL
Download sequence
Identical sequences G1KR32
XP_008109539.1.98722 ENSACAP00000015148 ENSACAP00000015148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]