SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008111490.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008111490.1.98722
Domain Number 1 Region: 26-190
Classification Level Classification E-value
Superfamily RUN domain-like 1.7e-43
Family RUN domain 0.0000569
Further Details:      
 
Weak hits

Sequence:  XP_008111490.1.98722
Domain Number - Region: 241-314
Classification Level Classification E-value
Superfamily Tropomyosin 0.0271
Family Tropomyosin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008111490.1.98722
Sequence length 456
Comment PREDICTED: RUN domain-containing protein 3A isoform X2 [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MEPSCLQSTMALGLSSKKVSSRNIAVERKNLITVCRFSVKTLLEKYTIEPIDDSSEEFVN
FAAILEHILSHRFKGDHGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTSR
AKGRAWIRVALMEKRMSEYIATALRDTRTTRRFYDDGAIMLREESTVLTGMLIGLSAIDF
SFCLKGEIMDGKTPVVIDYTPYLKFTQSYDYLSDEEDHRSLESSTSEDSSPDHPYLPLVT
AEDSWYNKWRKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENKRLQLRLEEAKVQNQL
EKRELEGVILELQEQLLPSSCSAPRTGLIPSDNTQFTQLSKEMAAPLVNQWPSLGTLNSN
EGRPDAKIYRRHSFMSTDQLSAEISLSSDSQRMGEGKHEEPWGPLGKDPTPSMLGLCGSL
ASLPSCKSLASLKSNECLITGPFGKSCYFLEIGRGI
Download sequence
Identical sequences G1KTQ3
ENSACAP00000017024 XP_008111490.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]