SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008116190.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008116190.1.98722
Domain Number 1 Region: 407-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.24e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 323-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 547-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-22
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 4 Region: 492-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.47e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 234-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.34e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 179-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-18
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 7 Region: 122-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.16e-18
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 8 Region: 42-84
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000432
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 9 Region: 370-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000981
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 10 Region: 454-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000038
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 11 Region: 286-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000123
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 86-134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000168
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008116190.1.98722
Sequence length 623
Comment PREDICTED: gastrula zinc finger protein XlCGF57.1 [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MCVAHIGNGEYIILDSETWPSNSSTTFHDSFRRRDSAGPYKVTFEDVSVDFSEEEWALLD
SSQKALHQQMMEENLGFLSSLEETQFKCLEDGMIFNWKEAPTFYQETHTRDEAFKYSECE
KSFSRKSNFVHHQETQTGEKPFKSPECGKSFSQKRVFVRHQATHKGNKPFKCLECGKNFS
QKGVLIRHKAIHTGKRSFKCPESGKSFSYMGGLVQHQATYRGEKPFKCPECGKSFYRKAH
LIFHQLAHTGERPFKCSECGKTFSQKSNLVRHQAIFHQRNYTEEKPFKCSECGKSFSHKS
KLVRHQVVHLGKKLCICSECGKSFSRKSNLVRHQAIHTGEKPFKCPECGKSFYQKVHLVI
HHLAHTGERPFKCLECGKGFSQSRDLVRHQNIHTGEKPFNCLECGKSFSWKTVLVRHQAT
HTGERPFQCSECGKGFSQKKDLVRHQKIHTGEKPFQCLECGKSFRWKAGFVHHQATHTGE
RPFKCSECGKGFNQKRDVVRHQKTHTGEKPFRCLECGKSFKRKIVLACHQATHTGEKPFK
CPECGKSFCQKSHLVRHHLAHTGERPFTCPECGKSFCQKSHLVRHHLAHTGEKPFKCSEC
GKSFRRKSDLVCHQKTHSGEKPF
Download sequence
Identical sequences XP_008116190.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]