SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008117168.2.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008117168.2.98722
Domain Number 1 Region: 361-584
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.9e-68
Family Nuclear receptor ligand-binding domain 0.000012
Further Details:      
 
Domain Number 2 Region: 98-188
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-29
Family Nuclear receptor 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008117168.2.98722
Sequence length 586
Comment PREDICTED: nuclear receptor subfamily 1 group D member 2 isoform X1 [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MELNAGGVITYISSSSSASSPASCHSEGSESSFQSSSSPVPTSPNSSPSESSCNIKSREV
FKEATKSDQLDDRIKANHSSPKGQIKGHSGLTKFNGMVLLCKVCGDVASGFHYGVHACEG
CKGFFRRSIQQNIQYKKCLKNNNCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKR
EKQRMLIEMQSAMKTMMNTQFSDHLPNETLKDSEEPVILLPQEELNSKMQREKETINRTS
PPPVLLPPLSAPPSDIAKEEVIGMVTRAHKDTFMYNQEQSENPPCVVQPQNGERNLKYTE
QYNSSGEPDHGDISSTQYGDSEQHFNGQYKGRNNVHYPNGRNLCFTSSSSMNFTHGFPLK
GCNRMPENGFPPNESMNAYSYNTGGRMHLVCPMNKTPFVDPNKSGHEVWEEFSMSFTPAV
KEVVEFAKRVPGFRNLSQHDQVNLLKAGTFEVLMVRFASLFDAKDRTVTFLSGKKYSLDD
LRSMGAGDLLNSMFEFSEKLNALNLSDEEMSLFTAVVLVSAERSGIENVNSVEALQETLI
RALRTLITKNHPNEASTFTKLLLKLPDLRSLNNMHSEELLAFKVHP
Download sequence
Identical sequences H9GHL2
ENSACAP00000011193 XP_008117168.2.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]