SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008117851.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008117851.1.98722
Domain Number 1 Region: 32-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-68
Family SPRY domain 0.00000000833
Further Details:      
 
Domain Number 2 Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000863
Family SOCS box-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008117851.1.98722
Sequence length 273
Comment PREDICTED: SPRY domain-containing SOCS box protein 4 [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MGQKISGSIKSVDVREPPYRPVKRELRGPDFCKPARLDMLLDMPPVQLEVQYKHAWNNED
RSLNIFVKEDDKLTFHRHPVAQSTDCIRGKVGYTRGLHVWQIHWPTRQRGTHAVVGVATA
EAPLHSVGYTSLVGSNNESWGWDLGRNKLYHNCKNQPGATYPVFLELDESFVLPDSLLVV
LDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEITMRYINGLDPEPLPLMDL
CRRSIRFALGRERLHDIETLPLPQSLKNYLQYQ
Download sequence
Identical sequences H9GME0
XP_003226762.1.98722 XP_008117850.1.98722 XP_008117851.1.98722 XP_016852505.1.98722 28377.ENSACAP00000015210 ENSACAP00000015210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]