SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008154660.1.99482 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008154660.1.99482
Domain Number 1 Region: 103-599
Classification Level Classification E-value
Superfamily Sema domain 7.59e-101
Family Sema domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1462-1588,1754-1910
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.29e-33
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 1031-1121
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000245
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.041
Further Details:      
 
Domain Number 4 Region: 941-1030
Classification Level Classification E-value
Superfamily E set domains 0.000000000000035
Family Other IPT/TIG domains 0.017
Further Details:      
 
Domain Number 5 Region: 1119-1201
Classification Level Classification E-value
Superfamily E set domains 0.0000000000759
Family E-set domains of sugar-utilizing enzymes 0.055
Further Details:      
 
Domain Number 6 Region: 602-653
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000222
Family Plexin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008154660.1.99482
Sequence length 1978
Comment PREDICTED: plexin-D1 [Eptesicus fuscus]; AA=GCF_000308155.1; RF=representative genome; TAX=29078; STAX=29078; NAME=Eptesicus fuscus; AL=Scaffold; RT=Major
Sequence
MRVISLSGPGGSPEWGTDDRCEDPGEEEPSFSAGKTVDATLPDTPGRVTWCSERSAYQEA
SGAFPAGKAFSEPRPNSRSPLLLPLPLLLLLLGAARAGALEIQRRFPSPTPTNNFALDGA
AGTLYLAAVNRLYQLSSANLSLEAEAAVGPVADSPLCHAPQLPQASCEHPRRLTDNYNKI
LQLDPGQGLVVACGSIYQGFCQLRRRGNISAVAVPFPPAAPPAEPVTVFPSMLNVAANHP
NASTVGLVLPPAAGTGASRLLVGATYTGYGSAFFPRNRSLEDHRFENTPEIAIRSLDARG
DLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPPDPPPGAPSYAYLALTSEARA
GDKESQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRLVSVFPAREL
LFAVFERPQGAPAPRAAPAALCAFSFADVQAAIRAARTACFVEPAPDVVAVLDSVVQGTG
PACERKRNIQLQPEQLDCGAAHLQHPLSILQPLKATPVFRAPGLSSVAVASVSNYTVVFL
GTASGRLLKINLNESMQVVSRRVVTVAYGEPVHHVMQFDPADPGYLYLMTSHQMVRVKVA
ACAVHTTCGDCVGAADAYCGWCALETRCTLQQDCANSSQQHFWTSASEGPGRCPTMTVLP
AEIDVRQEYPGMILQISGSLPSLSGMEMACDYGNNIRTVARVPGPAFGHQIAYCNLLPKD
QFPPFPPHQDHVTVEMSVRVNGRNIVRANFTIYDCSRIGQVYPHTACTSCLSTQWPCFWC
TQQHTCVSNQSRCEASPNPTSSQDCPQILPSALAPMPTGSSQTIPVRLANAAFFQSAALE
CNFGQEAIFEAVWVNDSAVLCNHVVLHTTQKSQVFPLSLQLKGRPARFLDSPDPMTVEVY
NCAMGSPDCSQCLGREDLGHLCVWSDSCRFRGPLQPLPGACPAPEIRAIEPLSGPLDGGT
LLTIHGRNLGRRLSDVAHGVWIGGVACEPLADRYTVSEEIVCATGPAAGAFSDVVTVNVS
KEGKSRERFSYVLPLVHSLEPAVGPKAGGTRITIHGSDLHVGSELQVLLNNTEPCTELMR
TETSITCTVPGGTLPAPVPVCVRFEHRGCVRGNLTFWYMRNPVIIAISPRRSPVSGGRTI
TVAGERFHMVQNVSMAVHPIGRQPTLCKVLNSTLITCPSPGALSNASAPVDFFINGRAYT
DEVAVAEELLDSEEAQRGSRFRLDYLPDPQFSTAKREKWIKHHPGEPLTLVIHKEQDSLG
LERHEYRVKIGQVACDIQIVSERVIHCSVNESLGTAEGQLPITIQVGNFNQTIATLQLGG
SETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFA
ELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYILPSQTLNSQGSSSVQ
ETHPLLGEWKIPESCRPNMEEGIGLFSSLLNNKHFLIVFVHALEQQKDFAVRDRCSLASL
LTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSCLR
ETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGM
DSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASGTQSYILRDLDDTS
VVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDNTLGRVKDLDTEKYFHLVLPTDELAEPK
KSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYFFDFLEEQ
AEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACS
ISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMTPLSEQEMNAHLAEESRKYQNE
FNTNVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVVALMEDNIYECYSEA
Download sequence
Identical sequences XP_008154660.1.99482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]