SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008154833.1.99482 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008154833.1.99482
Domain Number 1 Region: 263-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000681
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 2 Region: 883-935
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000465
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 719-765
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000354
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 4 Region: 940-989
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000143
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 398-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000387
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 6 Region: 850-891
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000279
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 7 Region: 757-815
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000567
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008154833.1.99482
Sequence length 1219
Comment PREDICTED: zinc finger protein ZFAT isoform X1 [Eptesicus fuscus]; AA=GCF_000308155.1; RF=representative genome; TAX=29078; STAX=29078; NAME=Eptesicus fuscus; AL=Scaffold; RT=Major
Sequence
MCKCCNLFSPSQSELLSHVSEKHTEEGVNVDEIIIPLRPLSTPEPAHPSKAGDELSVTKR
KRGRPKGSTKKPSAEEELVGSAVGASEAPPRAPEEGGSLAPRCLECPKCSRKFSNLRQLR
KHICIIVLSLGEAEGDAGNESDVELEKKFKEEDREKAPRRPRTQRTEKGQKVSSGKEAAQ
GPGAKKPIVSVVLTXXHAVPCASTAGATKIIPVEAGPPETGAANPEATSADLAPRRGYQE
YAIQQTPYEQPMKSSRLGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYTCAHCSY
ASAIKANLNVHLRKHTGEKFSCDCCAFTCLSKGHLKVHVERVHKKVKQHCRFCKKKYSDV
KNLIKHVRDAHDPQDPQVREALDGLRLLTREGKRQLLYDCHVCERKFKNELDRDRHMLVH
GDQWPFACELCGHGATKYQALELHVRKHPFVYVCALCRRTFVSSIRLRAHIREAHGAAPE
AAAFTSSINQSFCLLEPGGDIQPEALGGRLPLAEEGLAPKEDAEPQPGRREPEAPLQVPA
LPGPLVPTPQAGSTAPPPCELGAAGVPSGLPSQGAVSDELLLKSGTSSAEAHPAPGRTLH
PQPGGSAPSQGAEVTPLLPTARSPAANQDTQGAESPRSHGPDPNRCLGSDPAEAADLPVV
PGEEAEALRPPDFCGPGPGPGPERRANMNAFLRILDGLAKRRMDPGLCERIRKVYGDLEC
EYCGKLFWYQVHFDMHVRTHTREHLYYCSQCHYSSITKNCLKRHVIQKHSNILLKCPTDG
CDYSTPDKYKLQAHLKVHTELDKRSYSCPVCEKSFSEDRLIKSHIKTNHPEVSMSTISEV
LGRRVQLKGLIGKRAMKCPYCDFYFMKNGSDLQRHIWAHEGVKPFKCSLCEYATRSKSNL
KAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHTADGKQFKCTVCDYTAAQKPQLLRH
MEQHASFKPFRCAHCHYSCNISGSLKRHYNRKHPNEEYANAGAGELAADALVRQGGLKCP
VCSFVYGTRWEFNRHLKNKHGLKLVETEGEPKWEPATETPEEPAAQYLHIAEAEEDVQGT
QAAVAALQDLRYTSESGDRLDPTAVNILQQIIELGSEAHDATAVASVVAMAPGTVTVVKQ
VTDEEPSSNHTVMIQETLQQASVELAEQHHLVVSSDDVEGIETVTVYTQGGEPSEFIVYV
QEAMQPAEEPAGGQPAPEL
Download sequence
Identical sequences XP_008154833.1.99482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]