SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008154834.1.99482 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008154834.1.99482
Domain Number 1 Region: 195-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000624
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 2 Region: 815-867
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000431
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 651-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000332
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 4 Region: 330-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000117
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 5 Region: 872-921
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000132
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 782-823
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000231
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 7 Region: 689-747
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000477
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008154834.1.99482
Sequence length 1151
Comment PREDICTED: zinc finger protein ZFAT isoform X2 [Eptesicus fuscus]; AA=GCF_000308155.1; RF=representative genome; TAX=29078; STAX=29078; NAME=Eptesicus fuscus; AL=Scaffold; RT=Major
Sequence
MCKCCNLFSPSQSELLSHVSEKHTEEGVNVDEIIIPLRPLSTPEPAHPSKAGDELSVTKR
KRGRPKGSTKKPSAEEELVGSAVGASEAPPRAPEEGGSLAPRCLECPKCSRKFSNLRQLR
KHICIIVLSLGEAEGDAGATKIIPVEAGPPETGAANPEATSADLAPRRGYQEYAIQQTPY
EQPMKSSRLGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYTCAHCSYASAIKANL
NVHLRKHTGEKFSCDCCAFTCLSKGHLKVHVERVHKKVKQHCRFCKKKYSDVKNLIKHVR
DAHDPQDPQVREALDGLRLLTREGKRQLLYDCHVCERKFKNELDRDRHMLVHGDQWPFAC
ELCGHGATKYQALELHVRKHPFVYVCALCRRTFVSSIRLRAHIREAHGAAPEAAAFTSSI
NQSFCLLEPGGDIQPEALGGRLPLAEEGLAPKEDAEPQPGRREPEAPLQVPALPGPLVPT
PQAGSTAPPPCELGAAGVPSGLPSQGAVSDELLLKSGTSSAEAHPAPGRTLHPQPGGSAP
SQGAEVTPLLPTARSPAANQDTQGAESPRSHGPDPNRCLGSDPAEAADLPVVPGEEAEAL
RPPDFCGPGPGPGPERRANMNAFLRILDGLAKRRMDPGLCERIRKVYGDLECEYCGKLFW
YQVHFDMHVRTHTREHLYYCSQCHYSSITKNCLKRHVIQKHSNILLKCPTDGCDYSTPDK
YKLQAHLKVHTELDKRSYSCPVCEKSFSEDRLIKSHIKTNHPEVSMSTISEVLGRRVQLK
GLIGKRAMKCPYCDFYFMKNGSDLQRHIWAHEGVKPFKCSLCEYATRSKSNLKAHMNRHS
TEKTHLCDMCGKKFKSKGTLKSHKLLHTADGKQFKCTVCDYTAAQKPQLLRHMEQHASFK
PFRCAHCHYSCNISGSLKRHYNRKHPNEEYANAGAGELAADALVRQGGLKCPVCSFVYGT
RWEFNRHLKNKHGLKLVETEGEPKWEPATETPEEPAAQYLHIAEAEEDVQGTQAAVAALQ
DLRYTSESGDRLDPTAVNILQQIIELGSEAHDATAVASVVAMAPGTVTVVKQVTDEEPSS
NHTVMIQETLQQASVELAEQHHLVVSSDDVEGIETVTVYTQGGEPSEFIVYVQEAMQPAE
EPAGGQPAPEL
Download sequence
Identical sequences XP_008154834.1.99482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]