SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008166264.1.60341 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008166264.1.60341
Domain Number 1 Region: 32-548
Classification Level Classification E-value
Superfamily Sema domain 4.45e-96
Family Sema domain 0.00071
Further Details:      
 
Domain Number 2 Region: 1421-1544,1710-1867
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.04e-35
Family p120GAP domain-like 0.019
Further Details:      
 
Domain Number 3 Region: 982-1071
Classification Level Classification E-value
Superfamily E set domains 0.000000000000229
Family Other IPT/TIG domains 0.058
Further Details:      
 
Domain Number 4 Region: 892-971
Classification Level Classification E-value
Superfamily E set domains 0.000000000000369
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 5 Region: 551-603
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000235
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1071-1155
Classification Level Classification E-value
Superfamily E set domains 0.000000000777
Family E-set domains of sugar-utilizing enzymes 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008166264.1.60341
Sequence length 1934
Comment PREDICTED: LOW QUALITY PROTEIN: plexin-D1 [Chrysemys picta bellii]; AA=GCF_000241765.3; RF=representative genome; TAX=8478; STAX=8479; NAME=Chrysemys picta bellii; AL=Chromosome; RT=Major
Sequence
MAPRERGAKVLAPVLLLLALLGSPSAGLEVQHKFLSPTLTNNFALDGLGSKIYLAAVNRL
YQLSGPNLTLEVEEQVGPVLDNPLCHAPQLPQASCEHLKVETNNYNKILQPDPEQGIVVV
CGSIYQGFCQLRSMANISAVAVSFPPGSAGGGGDPVTVFPSMLNIAANHPNASTVGLVLR
PAGPAGGGRPDTRLLVGATYTGFGSPFFPRNQSLEDHRFENTPEIAIRALNARGDLAKLF
TFDLNPSDDNIFKIKQGAKARHKLSFVRAFLHPAPPPRGPGGASYAYLALNSEANAGDKE
SHSHSLLARICLAEPGRNASAGETKKLTESYIQVGLQCGAGGADGFTRLVSVFPATAALQ
LGPAAAPRPQELLFGVFERAAPPGARQHSALCAFRFGDIERSIRQARNSCFVEPDSGLVT
VLDSVVQGTGPACEKRNIQLQPEQLDCGAAHLQHPLAILQPIKATPVFKYQGLTSVAVSS
VNNYTVVFLGTANGRLLKINLNSATKIISRKSVSVAYGESVHPIMQFDPSDSSYLYLMTS
YQMTRVKVAACDQYTTCTECLAAADAYCGWCTMETRCSLQHECINSTEPNFWTSASEGVQ
QCPSMTITPLEINIDNDDKGMIIQINGNIPSLSGMEMSCDYGNNIYTVARVPGNDVNSFI
YCNFLPREKYPAFPPNQDHVIVQTAIRVNGKNIVWANFTIYDCKRTGNIYPKTACTSCLS
TKWKCYWCTKKYMCVSNYSDCEDSLKMNSTTDCPRIVPASLEPMPTGASQDIMISLANAA
FSKDTVLECHFGTDRTFEARWVNTSTVQCSSVLLHTSEKSHIFPVNLQLKDKPDRFIDSP
QMMTVEVYNCATGSTDCSQCLGREDMGHRCIWSESSSICRLNTESPQIPVMCPAPEIRKI
EPLSGPLEGGTLLTIRGRNLGRRFSDVVNAVKIGSVRCAPLWDRYMVSEAIVCQTGEAPS
IFSDVVTVNVSREGKSRERYSYVLPEVQSVAPGAGPKAGGTKVTIRGSNLSVGSDLRVLV
NSTKQCTNLTRTATTITCTMPAVELTMAVRLCVQFENKSCINDNITFKYERNPIITDINP
TRSQISGGRIITLEGHGFLMVQNVSMVVHSIGKEQTNCKVHTDTMITCPSPAASNLTVGS
KPALVDFYINGRLYTDDRLAPDEYMYPEEAQHTSKFSLEYYADPQFFTAKKEKWIKHHPG
EPLTLVIHKEPDNLSLESDEYQVKIGLLSCEIQIVSDKVIHCSVNESLSTSERQLPVTIQ
VGKFNQTIAMLHLGGGETAIIVSIVICSILLLLSVVGLFVFCTKSRRAERYWQKTLLQME
EMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYV
LPSQQLNSQVGCQVQETHPLLSGEWKIPENCRPNMEEGIALFSTLLNNKHFLIVFVHALE
QQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKDLLVDLIDASASKNPKLMLRRTESVVE
KMLTNWMSICMYSFLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENI
EAKPRNLNVSFQGCGMDSLSVRVMDTDTLSQVKEKILEAFCKNVPYSQWPRVEDVDLEWF
ATSTDSYVLRDLDDTSVMEDGRKKLNTLAHYKIPEGASLAMSLSDKKDTTLSRVKDLDTE
KYFHLVLPTDELIEHKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILCMRED
KPPVAIKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHI
DACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMPPLSEQ
EMNAHLAEESRKYRNEFNTNVAMAEIYKYAKRYRTQIVNALDSNPTTRRTQLQHKFEQVI
ALMEDNIYECCSEA
Download sequence
Identical sequences XP_008166264.1.60341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]