SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008171125.1.60341 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008171125.1.60341
Domain Number 1 Region: 197-505
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.66e-117
Family Glutaminase 0.00000454
Further Details:      
 
Domain Number 2 Region: 530-614
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000187
Family Ankyrin repeat 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008171125.1.60341
Sequence length 692
Comment PREDICTED: LOW QUALITY PROTEIN: glutaminase kidney isoform, mitochondrial [Chrysemys picta bellii]; AA=GCF_000241765.3; RF=representative genome; TAX=8478; STAX=8479; NAME=Chrysemys picta bellii; AL=Chromosome; RT=Major
Sequence
MRLWGSALFRELLRLSQSGGAGGSALRRPPAPFAAAVWSAGSLPIPRPGLPPPPARSVCT
RSEGALHEPGKGPPLSARAPPADNGNNNNYNGGQELAAGGGDNKMKQGLLPSLEDLLFYT
IAEGQEKIPVHKFITALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQS
NIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKKQSGGQVADYIPQLAKFSPDLWGVSLC
TVDGQRHSVGDTKVPFCLQSCVKPLKYAVAVNDLGTEYVHRYVGKEPSGLRFNKLFLNED
DRPHNPMVNAGAIVITSLIKQGANNAEKFDYMMQFMNNMAGNEYVGFSNATFQSERESGD
RNFAIGYYLKEKKCFPEGTDMVAILDFYFQLCSIEVTCESASVMAATLANGGFCPITGER
VLSPESVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGIILVVPNVMGLMCWSPPLD
KMGNSVKGIHFCHELVSLCNFHNYDNLRHFAKKLDPRREGGDQRVKSVINLLFAAYTGDV
SALRRFALSGMDMEQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDE
ALHLDTMMYLKFFKNSRSSTHLQRIPAMERKIKQFIKIXMAYSNHLQLDPKSQILTYVIV
ENEYEERVYFCLTVVYILQNISFISVLQEFSS
Download sequence
Identical sequences XP_008171125.1.60341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]