SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008255421.1.1745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008255421.1.1745
Domain Number 1 Region: 393-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-26
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.41e-26
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 3 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 505-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.99e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 449-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 547-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.69e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 281-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-16
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 8 Region: 226-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000018
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008255421.1.1745
Sequence length 608
Comment PREDICTED: zinc finger protein 527 isoform X1 [Oryctolagus cuniculus]; AA=GCF_000003625.3; RF=representative genome; TAX=9986; STAX=9986; NAME=Oryctolagus cuniculus; breed=Thorbecke inbred; AL=Chromosome; RT=Major
Sequence
MAVGLCKAMFQGLVTFRDVALDFSQEEWEWLNTSQKDLYKEVMLENYRNLVWLGISISKP
NMISLLEQGKEPWIVERKLSRGHRADWEPWCEIKELSPKCFIDDEEISQGMVMERPIRND
LECSSFRETWKCEGEFDHQGDQERHFRQVTTLKDISTGKRYNEYKNSEGSISLKPLFLTQ
QRLPTVQQIHKFDIYDRIFPPNSLIIDCKRLHSEKEPLVGNECEEFSQNTHFCRAIGIPS
GEKPYGGNTFSNLLGFHSWLSQHHTSHFGKLSHEYDECGAAFSCYSLFTQPRRIHRGEKA
YACNDCGKAFSRDFFLSARQRIRLGEKPYECKECNKAFRQSAHLAQHQRIHTGEKPFACN
ECGKAFSRYAFLVEHQRIHTGEKPYECKECNKAFRQSAHLSQHQRIHTGEKPYECEQCGK
AFSRRIALTLHQRTHTGEKPFQCSECGKTFGYRSHLNQHQRIHTGEKPYECIKCGKFFRT
DSQLNRHHRIHTGEKPFECSKCGKAFSDALVLIHHRRSHAGEKPYECSKCGKAFSCGSYL
TQHQRIHTGEKPYACDECGKAFHQILSLRLHQRIHAGEKLYTCNACGNNFSCASALRRHQ
RSHNRETL
Download sequence
Identical sequences ENSOCUP00000026157 XP_002711539.1.1745 XP_008255421.1.1745 XP_008255422.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]