SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008257993.1.1745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008257993.1.1745
Domain Number 1 Region: 227-482
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.89e-64
Family Eukaryotic proteases 0.000000147
Further Details:      
 
Domain Number 2 Region: 46-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-24
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 3 Region: 188-235
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000196
Family Complement control module/SCR domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008257993.1.1745
Sequence length 486
Comment PREDICTED: complement C1r subcomponent-like protein isoform X1 [Oryctolagus cuniculus]; AA=GCF_000003625.3; RF=representative genome; TAX=9986; STAX=9986; NAME=Oryctolagus cuniculus; breed=Thorbecke inbred; AL=Chromosome; RT=Major
Sequence
MPGPRMGKPWRSPPSTSCSGKIRWWLLLWGVLQACPTQGFVLLAQQHPQQFSSPGYPEPY
LKGQESALDIQAPEGFAVRLVFQDFDLEPSQDCEGDSVTISANGKDLSRLCGQQGSPLGS
CPSPREFVSSGRRLHLTFRTRSTLENKSAHLHRGFLAVYQAVAVNSSQPITKASRDSGAL
DTPVENTARIQNHCQEPYYQAVPPGTPACPAQGTWKDGRPKEEVPQCVPVCGRPVTPIVQ
DQTSRGSSKAQLGNFPWQALTSIYGRGGGALLGDRWILTAAHTIHPKDSVFPEKPRSVDV
FLGHTDVEEMIKLGNHPVRRVVMHPDYRPDESHNFTGDIALLELQQSVPLGPHLLPVCLP
DNETLYLSGKSGYVSGFGMAMGRLPTKLKYSRLPIAPREACEAWLRERQRTEVFSDNMFC
VRDNTWENSACQGDSGSVYVVWDDHAHRWVATGIVSWGVGCGTGYSFYTKVLNYVDWIKE
VMDSTE
Download sequence
Identical sequences XP_008257993.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]