SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008265325.1.1745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008265325.1.1745
Domain Number 1 Region: 267-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.73e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 186-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.91e-23
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 407-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 5 Region: 324-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 143-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-18
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 8 Region: 509-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.26e-17
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 9 Region: 115-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 76-128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000299
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 11 Region: 370-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000025
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 230-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000027
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008265325.1.1745
Sequence length 563
Comment PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 791-like [Oryctolagus cuniculus]; AA=GCF_000003625.3; RF=representative genome; TAX=9986; STAX=9986; NAME=Oryctolagus cuniculus; breed=Thorbecke inbred; AL=Chromosome; RT=Major
Sequence
MDSVVSEDVSVNFSREEWALLNPSQKKLYRDVMQETIRNLASVEVVWWXRNCESKKESQC
GDAFSQILSLSLTEKRTGVKPYECTVCGKDYVLHSSLVRHIRSHAGYKLAGSKYGEKPYK
CKVCGNAFSYLKSFQRHERTHTGENPYKCQQCGKTFIYHQPFQTHEQTHTGEKPYECQYC
GKSLSSSSSLRIHERIHTGEKPYACKKCGKAFSCPSSIQIHERTHTGEKPYTCKECGKAF
ISRTSVQTHMITHNGDRPYKCQECGKAFIRPSFLRVHERIHTGEKPYACKQCGKAFRCST
SIQIHERTHTGEKPYKCKDCGKAFRARPAFRVHLRVHTGEKPYKCKECGKAFSRLSYCRI
HERTHTGEKPYKCKKCGKTFNYPLDLQIHERNHTGEKPYECKQCAKAFISVENFRRHMIT
HTGDGPYKCRECGKAFSYLSALRTHERTHTGEKPYTCKRCGKSFSCSSYVQIHERTHTGE
KPYXCKQCGKAFIYPTSFQGHMRVHTGEKPYKCKECGKAFSLRSSSQRHERTHSGEKLYE
CKQCGKAFCLSRSLQKHVTMHTG
Download sequence
Identical sequences XP_008265325.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]