SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008267737.1.1745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008267737.1.1745
Domain Number 1 Region: 127-392
Classification Level Classification E-value
Superfamily vWA-like 1.33e-88
Family Trunk domain of Sec23/24 0.000000982
Further Details:      
 
Domain Number 2 Region: 8-66,409-517
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 7.72e-66
Family beta-sandwich domain of Sec23/24 0.00027
Further Details:      
 
Domain Number 3 Region: 621-761
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 2.17e-56
Family C-terminal, gelsolin-like domain of Sec23/24 0.00000511
Further Details:      
 
Domain Number 4 Region: 518-620
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 1.16e-47
Family Helical domain of Sec23/24 0.00000744
Further Details:      
 
Domain Number 5 Region: 49-121
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 5.62e-21
Family Zn-finger domain of Sec23/24 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008267737.1.1745
Sequence length 765
Comment PREDICTED: protein transport protein Sec23A [Oryctolagus cuniculus]; AA=GCF_000003625.3; RF=representative genome; TAX=9986; STAX=9986; NAME=Oryctolagus cuniculus; breed=Thorbecke inbred; AL=Chromosome; RT=Major
Sequence
MTTYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPVAALFTPLKERPDLPPIQYEPVL
CSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPTYAGISELNQPAELLPQFSSIEYV
VLRGPQMPLIFLYVVDTCMEDEDLQALKESMQMSLSLLPPTALVGLITFGRMVQVHELGC
EGISKSYVFRGTKDLSAKQLQEMLGLSKVPVTQATRGPQVQQPPPSNRFLQPVQKIDMNL
TDLLGELQRDPWPVPQGKRPLRSSGVALSIAVGLLECTFPNTGARIMMFIGGPATQGPGM
VVGDELKTPIRSWHDIEKDNAKYVKKGTKHFEALANRAATTGHVIDIYACALDQTGLLEM
KCCPNLTGGYMVMGDSFNTSLFKQTFQRVFTKDMHGQFKMGFGGTLEIKTSREIKISGAI
GPCVSLNSKGPCVSENEIGTGGTCQWKICGLSPTTTLAIYFEVVNQHNAPIPQGGRGAIQ
FVTQYQHSSGQRRIRVTTIARNWADAQTQIQNIAASFDQEAAAILMARLAIYRAETEEGP
DVLRWLDRQLIRLCQKFGEYHKDDPSSFRFSETFSLYPQFMFHLRRSPFLQIFNNSPDES
SYYRHHFMRQDLTQSLIMIQPILYAYSFSGPPEPVLLDSSSILADRILLMDTFFQILIYH
GETIAQWRKSGYQDMPEYENFRHLLQAPVDDAQEILHSRFPMPRYIDTEHGGSQARFLLS
KVNPSQTHNNMYAWGQESGAPILTDDVSLQVFMDHLKKLAVSSAA
Download sequence
Identical sequences G1SY70
ENSOCUP00000008549 9986.ENSOCUP00000008549 XP_008267737.1.1745 ENSOCUP00000008549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]