SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008281096.1.38333 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008281096.1.38333
Domain Number 1 Region: 453-587
Classification Level Classification E-value
Superfamily TIMP-like 2.12e-25
Family Netrin-like domain (NTR/C345C module) 0.022
Further Details:      
 
Domain Number 2 Region: 229-324
Classification Level Classification E-value
Superfamily Immunoglobulin 1.42e-19
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 407-460
Classification Level Classification E-value
Superfamily BPTI-like 2.55e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.003
Further Details:      
 
Domain Number 4 Region: 342-401
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000255
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.02
Further Details:      
 
Domain Number 5 Region: 144-196
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000457
Family Ovomucoid domain III-like 0.027
Further Details:      
 
Domain Number 6 Region: 54-100
Classification Level Classification E-value
Superfamily Elafin-like 0.00000301
Family Elafin-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008281096.1.38333
Sequence length 590
Comment PREDICTED: WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 [Stegastes partitus]; AA=GCF_000690725.1; RF=representative genome; TAX=144197; STAX=144197; NAME=Stegastes partitus; AL=Scaffold; RT=Major
Sequence
MHKIPLQHLEDIKDTSWHNAPNKLLPGWTRAYLLMLLVCDLLELSLCASVAGAKVKHDGL
CPNKLNSNLWVDAQSTCERECNIDEDCADFEKCCTNVCGLNSCVAARFSDGTPAQPDGQG
GEKGDATPATTATCEGFICSQQGATCDIWDGQPVCKCQDRCEKEPNFTCASDGLTYFNRC
YMDAEACIRGVSLTVVPCRFYLTGPHTSPLPQDTTVHPTPTSSQEDPLPPTLYSNPHHQS
IYVGGTISFHCDVIGVPRPDVTWEKQSDRRERLVMRPDQMYGNVVITNIGQLVIYNAQVW
DTGIYTCIARNSAGVLRADYPLSVIRRADDDFSEDPEMPMGRPFSPADCLAEVDLRVCSA
ERHVDWYYDSKLGSCMTFSNGGCDDSRNRFETYEECKASCQREGMGICSLPAVQGPCKAW
EARWAWNSVMKQCQAFAYGGCHGNANSFHTKKECEANCPQPKRKPCKTCRVKGKMVPSLC
RSDFAIVGRLTELVEDLDSGLARFSLEEVLRDEKMGLTFFNTKHLEVTIAKIDWSCPCPN
ITMEENPLLVMGTVQDGMAIIQSDSYVRAITERRLKKLRDVMTKKNCEAS
Download sequence
Identical sequences XP_008281096.1.38333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]