SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008287757.1.38333 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008287757.1.38333
Domain Number 1 Region: 29-513
Classification Level Classification E-value
Superfamily Sema domain 1.7e-101
Family Sema domain 0.00083
Further Details:      
 
Domain Number 2 Region: 1384-1509,1675-1859
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.69e-33
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 858-949
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000014
Family Other IPT/TIG domains 0.031
Further Details:      
 
Domain Number 4 Region: 948-1022
Classification Level Classification E-value
Superfamily E set domains 0.00000000000471
Family Other IPT/TIG domains 0.041
Further Details:      
 
Domain Number 5 Region: 1041-1119
Classification Level Classification E-value
Superfamily E set domains 0.00000000000827
Family E-set domains of sugar-utilizing enzymes 0.018
Further Details:      
 
Domain Number 6 Region: 515-568
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000959
Family Plexin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008287757.1.38333
Sequence length 1899
Comment PREDICTED: plexin-D1 [Stegastes partitus]; AA=GCF_000690725.1; RF=representative genome; TAX=144197; STAX=144197; NAME=Stegastes partitus; AL=Scaffold; RT=Major
Sequence
MPPSIEIAVLLLGVLALETRRSASALHIQQAFPSPNHTNNFVVDPVSRKVYLATVNSVYQ
LNGTLSVEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLKLDREQGVVVVCGS
VYQGFCELRKMENISEIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFKSHGGNTRLL
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNIKDLSRLFTYDINPSEDNVFKIKQ
EVKTKNKLNFVHAFIQKTYSYIAFNNDAKMGHKESQPNSILARICLDTENPRKSTGPESR
KLTESYIQMPLQCGFNGNIYNRLLSVYPAEIQSEDGQSSEPYLFGVFSKADRKSALCAFK
FGDIEEQIRQGRRNCSNSPSSDVQVLDSVIQGSGAACIQKGNLVLQPEQLDCGAAHLQHP
LALRRSLRATPLTEYPGLTSVSVDNVHNHTVVFLGTSNGRLRKLTLLANMTIANQWTLKL
PASEAVHHIMTFDPNDSNFLYVMTSHHMLRVKVAQCDQWRSCGDCLGARDAHCGWCTLEN
RCTIQEECAQGLLARSWISMSEGPQQCPSMTLTPPEISIAADIKDVGILINGSVPDLIGS
RVECEYGPGVSTAATVHLDYGPAQIQTCPLLPRENYQPILPGTDHLTVSVAIKVNGTSVV
SGSFIIYDCERTGAIHPKTSCVSCLSTRWKCYWDQENHLCVSSKDESKHNLLENAASCPS
LLASEVPPSPSGAAQDFILSLSNIQETEKLECDFGTEQRYEATWLNSSTVKCSGVTLFTN
QRSQVYHLNLRRRGFFGGQTEDVFVDSPQPMKVEVYNCGAGSSDCSQCWGREDQGHLCGW
CENSCRPRDDCQPIRDQCPAPEIHKISPLRGPVEGGTLLTVQGRNLGRRAGAVQVYIGDV
QCTLLPELYTVSTELVCQTGRSDFERTDFVQVEVDQSGTGTSKESFSYLMPKLLSMEPRK
GSRAGGTRVTIRGEHLDIGSQVMVKVNNSLECTITKKTDETIECTMPPALQAHTDSVTVC
VEFEDLPCQGVELSTTYTYEKNPTISYIHPIKSFLSGGRTITVTGQGFDLVQSVTMQVLG
IGKTRCEVLSDSTIICPSPASSQSQQTSVQFFLNGVLYMGDSPSPSDDEPEEEELEPHKG
HFMLEYVEDPQFFTANKEKLIKHHSGEPLTLIINKVPSDLELVPEEYSVMIGTYPCNISF
HNDQLFHCTINGMLSSSERELPVTVKVGNFNHTIAKVQLGGSELAIVVSIVVCCVLLLLC
TVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGI
PFLEYKQFVTRTFFPKMCSDYEKSLVQPAYENDGLGPRALPETHPLLQDWQATNTTRPNV
EEGITLFSTLLNNKHFLITFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKDL
LVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQIN
KGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLSVRVMNTDTICQVKEK
IIEAFYKNLPFSQWPRAEDVDLEWFDSGSNSKLLQDLDNSSVMEDGRKKLNTVFHYQIPE
GASLAMSMKDKKENTLGRVKDLDTEKYVHLVLPHDELMETKRSHRQSHRKKVLPEIYLTR
LLSTKGTLQKFLDDLFQAILSIPPDRPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTNS
LPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAK
EIPEYKKRVQCYYQQIQEMAPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYRN
QVVNALESNPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_008287757.1.38333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]