SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008315603.2.100486 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008315603.2.100486
Domain Number 1 Region: 451-585
Classification Level Classification E-value
Superfamily TIMP-like 7.38e-25
Family Netrin-like domain (NTR/C345C module) 0.07
Further Details:      
 
Domain Number 2 Region: 226-321
Classification Level Classification E-value
Superfamily Immunoglobulin 3.66e-20
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 403-457
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0045
Further Details:      
 
Domain Number 4 Region: 339-398
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000156
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.019
Further Details:      
 
Domain Number 5 Region: 141-193
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000527
Family Ovomucoid domain III-like 0.031
Further Details:      
 
Domain Number 6 Region: 51-97
Classification Level Classification E-value
Superfamily Elafin-like 0.00000157
Family Elafin-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008315603.2.100486
Sequence length 587
Comment PREDICTED: WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 [Cynoglossus semilaevis]; AA=GCF_000523025.1; RF=representative genome; TAX=244447; STAX=244447; NAME=Cynoglossus semilaevis; AL=Chromosome; RT=Major
Sequence
MTKTPPHLLKDTLLNQTQCRGPAWMFRSYLLMLLLCALPDLPLCASVAGSKVEHEGLCPN
KLNSNLWVDAQSTCERECSVDEDCADFEKCCTNVCGLNSCVAARFSDGTPAQPDGQGGGD
SDDPPTAIATCEGFICSQQGATCDIWDGQPICKCQDRCEKEPNFTCASDGLTYFNRCYMD
AEACIRGVTLTVVACRFYLAGPHTSPLPQDTTAYPTPTSSQEEPLPPTLYSNPQHQSIYV
GGTVSFHCDVVGVPKPDITWEKQSERREHLVMRPDQMYGNVVITNIGQLVIYNAQVWDTG
VYTCIARNTAGVLHADYPLSVIRRANDDFFEDPEMPMGRPFSPADCLAELDHRVCSAERH
VDWYYDIKTGTCTAFSNGGCDDSRNRFETYEECKASCQREGMGICSLPPVQGPCKSWEAR
WAWNSVMKECQAFAYGGCHGNANSFRTKKECDANCPQPKRKPCKTCRLKAKMVASLCRSD
FAIVGRLTELVEDLDSGLARFSLEEVLRDEKMGLTFFNTKHLEVTIAKIDWTCPCPNITM
EEHPLLVMGVVHDGMAIIQSDSYVRAITERRLRRLRDTLGKRPCETP
Download sequence
Identical sequences XP_008315603.2.100486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]