SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008338991.1.92800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008338991.1.92800
Domain Number 1 Region: 476-758
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-76
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 65-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.95e-18
Family alpha-D-mannose-specific plant lectins 0.008
Further Details:      
 
Domain Number 3 Region: 169-262
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000011
Family alpha-D-mannose-specific plant lectins 0.0094
Further Details:      
 
Weak hits

Sequence:  XP_008338991.1.92800
Domain Number - Region: 280-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0153
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008338991.1.92800
Sequence length 776
Comment PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase LECRK3 [Malus domestica]; AA=GCF_000148765.1; RF=representative genome; TAX=3750; STAX=3750; NAME=Malus domestica; cultivar=Golden Delicious; AL=Chromosome; RT=Major
Sequence
MLIRSYSMPFTVGFVLAMAFVVAQAQRMQSNISRGSSLTPTTNSSWLSRSGVYAFGFYKQ
GNGYAVGIFLAGIPQTTIVWTAKRDDPPLSSNVTLNFTSDGFGLISTQGQSFVIEYTSAS
SASMLDSGNFVIYNARQDIVWQSFEHPTDTLLPGQSLFAGDXLFSAKSESDHSTGIFRLK
MQADGXLVQYPVNTPDTAPYAYYSSRTYGRKNVTLNFGADGHLYLLNDTGSNIRNITDGG
LPADQATIYLMRIDADGIFRLYSHDLNHNGSKSIVWESSKDKCDPKGVCGLNSYCVSMDL
DAKCKCLPGFVFANLGNKTSSCRRIVADVCEYKNETFPYTMEELQSTIWEDSSYVDLPLS
DKEACKGACLEDCNCEAAIFNGTSCRKQRLPLRYGRREVSTPNLELIKVATSXTAPDTEK
RSKRKGRTDILIISISLAAFGSILFAISVVVLCKHNVWSYGRVNIPILDSELNEDIALRP
YTYEELEKITNNFGEEIGRGASGTVYKGVILASQKRVAVKRLQKVTAEGEKEFQTELKVI
GKTHHKNLVRLLGYCLDGPKRLLVYEYMSNGSLADVLFAPDRQPCWEERMRIARNIARGF
LYLHEECDTQIIHCDIKPQNILMDEYMCPKIADFGLAKLLKADQTRTTTGIRGTKGYVAP
EWHRKMPITVKADVYSFGVVLLEIICCRRNVDWSLPEEEAILDELAYPCFESGEHGKLVG
EQEVDTRQFERMIKVALWCIQDEPSLRPCMKKVLLMLEGTVEIPIPPSPNSILSTI
Download sequence
Identical sequences XP_008338991.1.92800 MDP0000189901|PACid:22644597 MDP0000189901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]