SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008369951.1.92800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008369951.1.92800
Domain Number 1 Region: 489-785
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-71
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 66-211
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-26
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Weak hits

Sequence:  XP_008369951.1.92800
Domain Number - Region: 336-390
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000451
Family Pan module (APPLE domain) 0.04
Further Details:      
 
Domain Number - Region: 287-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0189
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008369951.1.92800
Sequence length 812
Comment PREDICTED: putative receptor protein kinase ZmPK1 [Malus domestica]; AA=GCF_000148765.1; RF=representative genome; TAX=3750; STAX=3750; NAME=Malus domestica; cultivar=Golden Delicious; AL=Chromosome; RT=Major
Sequence
MKHQHVRCFLTFAFITLFSHSSSAIPKTRNRLSRGSSISVQDDSDFLTSPDESFTCGFYG
VGTNXFWFSIWFTKSIDRAVVWTANRDRPVNGLGSRLSLRRDGAMVLTDXDGTAVWGTXV
NSRADXAVLLDSGNLVLKDKRGKVLWQSFDIPTHTLLPNQPFTKSKKLISTLGKGTFGTG
YFSFSFDNDNVLKLMFDGPDTSSLYWPDPDYNVFAGGRTNYNSXRVAVLDELGNFFSSDX
LQFTASDAGSSAKRRLTMDYDGNLRLYSLESTTGLWVVTWEAMTELCKVHGICGRNGICI
NTPQPKCSCPPGYEVADTSDWKEGCKPMFNRSYLRSQQXKFVQIEQVDFYGFDLNYSEPT
TFENCTNLCLDDXRCEGFSYRIXEAKCFTKSALFNGYKSPNFPGSMYIRLPXSVKTSXPV
NLNASNTCRKNVTKVVPSMYGSTVRRVKWVYMYWFAFAIGALEVLFIASAWWLLFRRHSA
AAPTEDGYHIISSQFRKFRYAELKKATKNFKEELGRGASGAVYKGVLADERVVAVKKLAD
IYHGEEVFWAEVSTIGKINHMNLVRIWGFCSDKKHKLLVSEHVENGSLDKHLFPPINFLG
WQERFKVAIGIAKGLAYLHHECLEWVIHCDVKPENILLDGNFEPKIADFGLAKLTQRGNL
SSVXSQIRGTKGYMAPEWXXNLPITAKVDVYSFGVVILELVKGIRLSSWVVEDTDDLETE
LTRFVRVAKRKIQCGKDLWIEDMMDPRLNGQFSRIQAAKMVEIGISCVEEEKSKRPTMDS
VVKILLECEGESAVASPHDTSNSNLSFRERNM
Download sequence
Identical sequences XP_008369951.1.92800 MDP0000630739|PACid:22677076 MDP0000630739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]