SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008373957.1.92800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008373957.1.92800
Domain Number 1 Region: 474-762
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-79
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 81-203
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-23
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008373957.1.92800
Sequence length 816
Comment PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5 [Malus domestica]; AA=GCF_000148765.1; RF=representative genome; TAX=3750; STAX=3750; NAME=Malus domestica; cultivar=Golden Delicious; AL=Chromosome; RT=Major
Sequence
MGRFQIRALCFCVLLLVFKTCIADEQHKDRIYPGFQASQVDWSDHVGLFLLSNNSAFALG
FYQALDVKLYLLVIIHLGTDKVVWTANRGKLISKSAKFVFDKNGSAYLRGSDSVAWSTNT
TGQVASAMELQDSGNLVLLGDKGSILWQSFSHPTDTLLPGQEFLQGMQLKSFRNSNNVFH
YLEIQSGDLVLYTGYEPPQIYWSLAVDSRMSNNNVIGNIHSLSLASNALNFYDANKSLLW
QFVFSDNKDPNAFWSAALGADAVISFYDLQKGKSVTSEATKIPQNSCSTPEPCAPYFVCY
FDNWCQCPSLLTSRFNCRPQALPTCNSSRSSTELLYVGEKLDYFALQFTKPSLLKSNLSS
CKEACISNCSCLVLFFESSSGHCYMFDRVGSFERSGANSTGYISYMKILSDEGINAGQGK
GNRSKHILLIMVILIATIVVIAGLVYMGFLYYRRKRLLDYSQEILEEDKFLDSLSGMPIR
FMYGDLSRATKNFSNKIGQGGFGSVYVGELPDGIQLAVKKLEGLGQGKKEFRAEVTIIGK
IRHVHLVKLRGFCAEGPHRLLVYEYMGKGSLDKWIFNSNKKEAVLDWNTRFNIALGTAKG
LAYLHEECEEKIVHCDIKPENVLLDDNFVAKVSDFGLAKMMNREENLVHTTVRGTRGYLA
PEWVTNHAISEKSDVYSYGMVLLEIIGGKRNFDPVNSSERGHFPSYAFKLLEEGNLKQFL
DPKLDVDENDERVVTAINVALWCIQDEMHMRPPMTKVVQMLEDLSALPPPRISSSSLSDR
RVSFLQWSGKEASSSSGLTNYNSDRLLSDIQLSGPR
Download sequence
Identical sequences MDP0000810486 MDP0000810486|PACid:22630006 XP_008373957.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]