SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008378886.1.92800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008378886.1.92800
Domain Number 1 Region: 44-207,294-398
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.75e-36
Family FAD-linked reductases, N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008378886.1.92800
Sequence length 450
Comment PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic-like [Malus domestica]; AA=GCF_000148765.1; RF=representative genome; TAX=3750; STAX=3750; NAME=Malus domestica; cultivar=Golden Delicious; AL=Chromosome; RT=Major
Sequence
MATATQATLSLFAAPLPAKPRSLTIRCLKSTTRTTNPPIVGRKLRAAVIGAGPAGSSAAE
ALATGGVECFMFERSGPSTAKPCGGAIPLCMLDEFDIPSHLIDRQVTRMRIFSPSNLAVD
FGKTLLPHEFIAMLRREVLDSYLRTRAQSRGANLISGLVTDLEVPTSVDAPYVISYTADN
KRESLAVDVVIGADGANSRVAKSIKAGDYACAIAFQERIKLPDDKMDYYQDLAEMYVGND
VSPDFYAWVFPKCDHVAVGTGTVCSKQDIKVFQRAIRARAHSKISGGKVIKVEAHPIPEH
PRPTRVRGRVALVGDAAGYVTKCSGEGIYFAAKSGRLCGEAIVKASEGGERMINEGDLKR
EYLKEWDGKYITTFRFLDLLQKVFYGSDAAREALVELCGDEYVQRMTFESYLYKKLADGN
RWEDAKMVLNTIGSLVRCNILGTKMEGLKL
Download sequence
Identical sequences XP_008378886.1.92800 MDP0000771633|PACid:22649768 MDP0000851102|PACid:22674240 MDP0000771633 MDP0000851102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]