SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008393939.1.92800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008393939.1.92800
Domain Number 1 Region: 7-225,329-390
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.75e-38
Family FAD-linked reductases, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 227-329
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000000000011
Family D-aminoacid oxidase-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008393939.1.92800
Sequence length 401
Comment PREDICTED: probable sarcosine oxidase [Malus domestica]; AA=GCF_000148765.1; RF=representative genome; TAX=3750; STAX=3750; NAME=Malus domestica; cultivar=Golden Delicious; AL=Chromosome; RT=Major
Sequence
MEYSGDEYDIIVVGAGIMGSSTAYQTSKRSQKTLLLEQFDFLHHRGSSHGESRTIRATYP
EDYYXPLVMESYKLWQQAESEIGYNVYFKAHQLDMAPANDKVLHAVVESCRKNXVAFRVM
NRDQXDQEFSGRVMIPEDWVGVVTEHGGVIKPTKAVSMFQTLALQNGAVLRDNMEVKGVE
RDRVRGGVWVCTANGERFWGKKCVVTVGAWTTKLVKTVGGVELPIQPLETTVCYWRIKEG
HEGGFAIGGDFPTFASYGNPYIYGTPSLEYPGLIKVAVHGGYPCDPDNRPWGPGNPLAPL
KEWIEGRFSGVVDSGGPVATQLCMYSMTPDEDFVIDFLGGEFGKDVVVGGGFSGHGFKMS
PVVGRILADLALTGEAQGVELKHFRIARFQENPKGNAKHFL
Download sequence
Identical sequences XP_008393939.1.92800 MDP0000289536|PACid:22677728 MDP0000289536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]